SecReT4
Protein ID: 237809181
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2440
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2663856..2664536 [+]
Productputative secreted protein
Component typeTfc12
UniProt IDC4L9T2
KEGG IDtau:Tola_2440
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.8e-87, Aligned region: 5..206
Protein Sequence: 226 a.a.     [Download]
>gi|237809181|ref|YP_002893621.1| putative secreted protein [Tolumonas auensis DSM 9187]
MSRFRNEVAHLQAHIKTLRLGAVALLLIALVMGGGWWSAPRDLTIHVPPDLRSGSTRPWWDVPPESVYSF
TFYVWQQLHRWPTNGEEDYARNLHALSPYFTPACRAFLQADYDYRRSTGELRQRVRGVYEIPGRGYGDNP
TARVRTVSDRNWVVTLDLSADEYHGPEQVKRALVRYPLKVARSDVDPARNPFGLVLDCYDGAPQRIATPE
PEPPARGGLGQQGDSP
 
Nucleotide Sequence: 681 bp     [Download]
>ref|NC_012691.1|:2663856-2664536 putative secreted protein [Tolumonas auensis DSM 9187]
ATGAGCCGCTTCCGGAACGAAGTCGCGCACCTGCAAGCGCACATCAAAACCCTGCGCCTGGGCGCTGTTG
CGCTGCTGCTGATCGCGCTGGTGATGGGCGGCGGCTGGTGGAGCGCGCCCCGCGACCTGACCATTCACGT
TCCGCCCGATCTGCGCTCGGGCAGCACCCGGCCCTGGTGGGACGTGCCGCCGGAGAGCGTCTATTCATTC
ACTTTTTATGTGTGGCAGCAACTGCACCGCTGGCCCACGAATGGCGAAGAGGACTACGCGCGCAACCTGC
ATGCGCTATCGCCGTACTTCACCCCCGCCTGCCGCGCCTTTCTGCAGGCCGACTATGACTACCGCCGTTC
TACGGGAGAGCTGCGCCAGCGGGTGCGTGGCGTGTATGAGATCCCCGGGCGCGGCTACGGCGACAACCCG
ACCGCGCGCGTGCGCACGGTCTCCGATCGCAACTGGGTGGTGACGCTCGATCTCAGCGCGGACGAGTACC
ACGGGCCGGAGCAGGTCAAGCGCGCGCTGGTGCGCTACCCGCTCAAAGTCGCGCGGTCGGACGTTGATCC
CGCGCGCAACCCCTTCGGCCTGGTTCTCGACTGCTACGACGGTGCGCCGCAGCGCATCGCTACGCCCGAA
CCGGAGCCACCTGCTCGCGGCGGCCTGGGCCAGCAAGGAGACTCCCCATGA
 Primer design