SecReT4
Protein ID: 237809182
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2441
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2664533..2665435 [+]
Productputative secreted protein
Component typeTfc13
UniProt IDC4L9T3
KEGG IDtau:Tola_2441
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 6.3e-126, Aligned region: 4..281
Protein Sequence: 300 a.a.     [Download]
>gi|237809182|ref|YP_002893622.1| putative secreted protein [Tolumonas auensis DSM 9187]
MKTRLLVWLGMLACALVPMAHAVEILRWERLPLAVPLQVGEERIVFVDRNVRVGVPASVGDRLRVQSAGG
AVYLRASEPIEPTRLQLQDADSGALILLDIAAEPAKDGEPPLEPVRIVEGNATPQRYGQAQESGTAAPSP
DQARPPRRETPVAVVLTRYAAQNLYAPLRTVEPVPGVMRVNLRRDLPLDTLLPTLPVRAEALAAWRLEDQ
WVTAVRLTHTGGGWIDLDPRALQGDFLTATFQHPTLGPRGTPEDTTVLYLVTRGRGLPQSLLPAIHRFDP
AALLPQVAPGHDLKESGDAQ
 
Nucleotide Sequence: 903 bp     [Download]
>ref|NC_012691.1|:2664533-2665435 putative secreted protein [Tolumonas auensis DSM 9187]
ATGAAGACCCGCCTTCTCGTCTGGCTGGGCATGCTGGCCTGCGCGCTCGTGCCCATGGCCCATGCCGTGG
AAATCCTGCGCTGGGAGCGCCTGCCTCTGGCCGTGCCGCTGCAGGTCGGAGAGGAACGCATCGTGTTCGT
GGATCGCAATGTACGCGTCGGCGTTCCGGCCAGCGTCGGCGACCGGCTGCGCGTGCAGAGTGCCGGCGGC
GCGGTCTATCTGCGCGCCAGCGAACCGATCGAGCCCACGCGACTGCAATTGCAGGATGCTGACAGCGGCG
CGCTGATCCTGCTGGACATCGCTGCCGAGCCGGCCAAGGACGGCGAGCCGCCGTTGGAGCCAGTGCGCAT
CGTCGAGGGCAACGCCACGCCGCAGCGCTACGGCCAGGCACAGGAATCCGGCACCGCTGCACCATCCCCA
GATCAAGCCCGTCCGCCCCGGCGCGAAACCCCGGTGGCAGTGGTGCTGACCCGCTATGCGGCCCAGAACC
TGTACGCCCCGCTGCGCACCGTGGAGCCCGTGCCCGGCGTCATGCGCGTGAATCTGCGCCGCGACCTGCC
GCTCGATACCTTGCTGCCGACCCTGCCTGTACGCGCCGAGGCGCTGGCGGCATGGCGGCTGGAGGATCAG
TGGGTGACCGCCGTGCGGCTGACCCATACCGGCGGCGGCTGGATCGATCTCGATCCGCGCGCGCTGCAAG
GGGACTTTCTCACCGCCACCTTCCAGCATCCGACGCTCGGTCCGCGCGGCACGCCGGAGGACACCACGGT
GCTGTATCTGGTCACGCGCGGTCGCGGCCTGCCGCAGTCGCTGCTGCCGGCCATCCACCGCTTCGACCCG
GCCGCACTGTTGCCCCAGGTCGCTCCTGGTCACGACCTCAAGGAGTCCGGCGATGCGCAGTAA
 Primer design