SecReT4
Protein ID: 237809183
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2442
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2665425..2666834 [+]
Productputative secreted protein
Component typeTfc14
UniProt IDC4L9T4
KEGG IDtau:Tola_2442
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 469 a.a.     [Download]
>gi|237809183|ref|YP_002893623.1| putative secreted protein [Tolumonas auensis DSM 9187]
MRSNGLLKWLVLPVALLVLFFGIRLFSGGGDQPPTSVDAEPQLTAEEMQALGIEGDTPRDTVATLVAQVR
QLRTELQTATADNRTQREENQRLRQRESAIDQRIGTALEAERTALRRDQEQLAGERRQTEGLLQDLQRRL
ENIGGGGHADLPVGLGLREGDGDGFAGEGGIRWVEPDDARQTDGRGGAGTSLSFPTSFGPAQKTLEATVG
HVADAGARAAGVKTAQAVYTVPTNSTLMGSVAMTALIGRVPVDGTVNDPFPFKVLVGPDNLTANGIDIPD
VAGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTVRTIPEDSERSSQQNNQQDGLGWISDPYGIPCVSGE
RRSNAQQYLGTQALITAAGAGVASLIDSDSGQMSYVGADGSIGTVGISTNEAVGRILAGGVQDMSQWVNR
LYGQAFAAVYVQPGAQVAVHLEKPLEIDYDPEGRRVDHRAGEAHALELD
 
Nucleotide Sequence: 1410 bp     [Download]
>ref|NC_012691.1|:2665425-2666834 putative secreted protein [Tolumonas auensis DSM 9187]
ATGCGCAGTAACGGCTTGCTCAAATGGCTAGTGCTTCCGGTCGCCTTGCTGGTGCTGTTCTTTGGCATCC
GCCTGTTCTCCGGCGGCGGCGACCAGCCCCCCACCAGCGTCGATGCCGAACCGCAGCTCACCGCCGAAGA
AATGCAGGCGCTCGGCATCGAGGGCGATACGCCCCGCGATACGGTCGCCACCCTGGTGGCGCAGGTGCGG
CAGTTGCGCACCGAATTGCAGACGGCCACGGCGGACAACCGCACCCAGCGCGAGGAAAACCAACGCCTGC
GCCAGCGCGAAAGCGCGATCGACCAGCGTATCGGCACGGCGCTGGAAGCCGAGCGCACCGCATTGCGTCG
CGACCAGGAGCAACTGGCCGGCGAGCGCCGGCAGACCGAAGGTCTGTTGCAGGATCTGCAGCGCCGGTTG
GAGAACATCGGTGGCGGCGGTCATGCCGATCTGCCGGTCGGATTGGGTTTGCGCGAAGGTGACGGCGATG
GTTTCGCTGGCGAAGGCGGTATCCGCTGGGTGGAGCCGGATGACGCCAGGCAGACCGACGGACGCGGCGG
CGCGGGTACAAGCCTGAGCTTCCCGACCAGCTTCGGACCGGCACAGAAAACGCTGGAGGCCACCGTCGGG
CATGTTGCCGATGCCGGTGCCAGGGCTGCCGGCGTCAAGACGGCCCAGGCGGTCTACACCGTACCGACGA
ACTCCACCCTGATGGGATCGGTCGCGATGACCGCATTGATCGGCCGTGTCCCGGTCGATGGCACCGTCAA
CGACCCGTTCCCGTTCAAAGTCCTCGTCGGGCCGGACAATTTGACCGCCAACGGCATCGACATCCCGGAT
GTGGCTGGCGCGGTGTTCAGTGGCACTGCCAGCGGCGACTGGACCTTGTCCTGCGTCAGGGGGCAGGTAC
GTAGCATCACGTTCGTGTTCCATGACGGGACTGTGCGCACGATTCCCGAAGACAGCGAGCGCAGCAGCCA
GCAGAACAACCAGCAGGATGGCCTGGGCTGGATCAGCGATCCGTATGGGATTCCTTGTGTCAGTGGCGAA
CGCCGCAGTAATGCGCAGCAGTATCTCGGTACCCAGGCCTTGATCACCGCCGCGGGCGCGGGCGTCGCTT
CGCTGATCGACTCCGACAGCGGCCAGATGTCCTATGTCGGTGCCGATGGCTCGATCGGCACGGTCGGCAT
CAGCACCAACGAGGCGGTCGGACGCATCCTCGCCGGCGGCGTGCAGGACATGTCGCAGTGGGTGAACCGG
CTCTACGGCCAAGCCTTCGCGGCGGTCTATGTCCAGCCCGGCGCACAGGTCGCCGTTCATCTCGAAAAAC
CCCTTGAGATTGACTACGACCCCGAAGGCCGCCGCGTCGACCATCGCGCAGGAGAAGCTCATGCACTCGA
ACTGGATTAA
 Primer design