SecReT4
Protein ID: 237809184
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2443
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2666815..2667249 [+]
Productputative secreted protein
Component typeTfc15
UniProt IDC4L9T5
KEGG IDtau:Tola_2443
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 144 a.a.     [Download]
>gi|237809184|ref|YP_002893624.1| putative secreted protein [Tolumonas auensis DSM 9187]
MHSNWIKPLLLAAAVAALAGCATSKEELMPHGGRTMQDIWHQAAGDGGSGQVARRQLLDARQSLRRPLTD
ADVQAAPAEQMRYTRTAANEIHHQFPRLLNPDLVMYVYPHLAGTDPVPVPGYSTVFPLYQRVQYAMPGER
TEAY
 
Nucleotide Sequence: 435 bp     [Download]
>ref|NC_012691.1|:2666815-2667249 putative secreted protein [Tolumonas auensis DSM 9187]
ATGCACTCGAACTGGATTAAACCGCTGCTGCTGGCGGCGGCCGTGGCGGCGCTGGCCGGCTGCGCCACCA
GCAAGGAAGAATTGATGCCGCATGGCGGCCGCACGATGCAGGACATCTGGCACCAGGCGGCCGGCGACGG
CGGCAGCGGTCAGGTGGCTCGCCGCCAACTGCTGGACGCGCGCCAGAGCCTGCGCCGGCCGCTGACGGAT
GCGGATGTACAGGCCGCGCCCGCCGAGCAGATGCGCTACACGCGTACGGCCGCGAACGAAATCCATCACC
AGTTCCCGAGGCTGCTGAATCCAGACCTGGTGATGTATGTGTATCCGCATCTGGCCGGCACCGATCCCGT
GCCGGTGCCAGGCTATTCGACTGTTTTCCCCTTGTATCAGCGCGTCCAGTACGCGATGCCGGGCGAACGC
ACGGAGGCGTACTGA
 Primer design