SecReT4
Protein ID: 237809185
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2444
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2667249..2670125 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDC4L9T6
KEGG IDtau:Tola_2444
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.4e-67, Aligned region: 62..337
AAA_10 [PF12846], Evalue: 7.6e-46, Aligned region: 530..869
FtsK_SpoIIIE [PF01580], Evalue: 2.1e-05, Aligned region: 527..560
Protein Sequence: 958 a.a.     [Download]
>gi|237809185|ref|YP_002893625.1| hypothetical protein Tola_2444 [Tolumonas auensis DSM 9187]
MAWSLPWRRRAPNDAAQIDDRQDGWTRHVRALREAGIPEPGEAVAPSRPATVADEQALYDAAPSFVALLP
WVEYLPDSQCMLLEDGVSVAAFFELTPLGTEGREAAWLARARDALENALQDSFDELDANPWVLQLYAQDE
ANFDQYLDTLRGYVQPRAEGSRFTEFYLTSFAHHLRAVAKSGGLFEDTAVTRLPWRGQSRRVRMVVYRRA
AGQTGRRGQTPEQALNVVCDRLIGGLSNAGIQTRRLDAPQIHDWLLRWFNPRPTMLGPTAQDRERFYRLA
AYPEAPESDEIELASGKDFSQRLFFGQPRSDAELGLWYFDSLPHRVMVTDRLRMPPATGHLTGETRKGDA
INTLFDQLPEGTVMCLTLVATPQDILEAHLNQLAKKSVGETLASEQALQDVQEARSLIGSSHKLYRGSLA
FYLSGDDEDELDRRGLQLANVMLNAGLQPVREEDEVAPLNSYLRWLPCVYNPGADRKQWYTQLMFAQHAA
NLSPAWGRSQGTGRPGITLFNRGGGVLTFDPFSRLDRQMNAHLFLFGPTGSGKSATLNNILNQVAAIYRP
RMFIVEAGNSFGLLADFAARLGLSVNRVKLAPGSGVSLAPFADARRLIESPSDVQTLDADALDEEQPVDP
AAVDTDEQRDVLGELEITARLMITGGEDKEESRMTRADRSLIRQCILDAARHCVAQDRDVLTRDVRDALR
ERGRDSTLPETRRTRLLEMADAMDIFTQGSDGEMFDRPGTPWPEADITVVDLATYAREGYNAQLSIAYIS
LINTVNNIAERDQFLGRPILNVTDEGHIITRNPLLSPYVVKITKMWRKLGAWYWLATQNIDDLPRAAEPM
LNMIEWWLCLSMPPDEVEKIARFRELSPAQKALMLSARKESGKFSEGVILSKSMEVLFRAVPPSLYLALA
QTEPEEKAERYRLMQQFGINELEAALKVSENIDRARGIEPLPYADLLS
 
Nucleotide Sequence: 2877 bp     [Download]
>ref|NC_012691.1|:2667249-2670125 hypothetical protein Tola_2444 [Tolumonas auensis DSM 9187]
ATGGCCTGGTCGTTGCCCTGGCGCCGGCGGGCACCTAACGATGCGGCGCAGATCGATGACCGGCAGGATG
GCTGGACGCGCCATGTACGCGCGCTGCGCGAGGCCGGCATTCCCGAACCCGGCGAGGCGGTCGCGCCCAG
CCGCCCGGCCACGGTGGCCGATGAGCAGGCACTGTACGATGCGGCACCGTCATTCGTCGCGCTGCTGCCG
TGGGTTGAGTACCTGCCGGATTCGCAGTGCATGCTGCTTGAGGATGGCGTCTCGGTTGCCGCCTTTTTCG
AGCTGACGCCGCTGGGCACTGAAGGTCGCGAGGCCGCCTGGCTGGCACGGGCACGCGATGCGTTGGAAAA
CGCCTTGCAGGACAGCTTCGACGAGCTCGATGCGAATCCATGGGTGCTCCAGCTCTACGCCCAGGACGAG
GCCAACTTTGACCAGTACCTGGACACGCTGCGCGGCTACGTTCAGCCGCGTGCCGAGGGTAGCCGCTTCA
CGGAGTTCTACCTGACCTCGTTCGCCCACCATCTCCGCGCCGTTGCCAAATCCGGCGGGCTGTTCGAGGA
CACGGCTGTCACACGCCTGCCGTGGCGCGGTCAGAGCCGGCGCGTGCGGATGGTGGTCTATCGCCGCGCT
GCGGGCCAGACCGGCCGCCGCGGCCAGACACCCGAGCAGGCGCTGAACGTCGTGTGCGACCGCCTGATTG
GCGGCCTGTCCAACGCGGGTATCCAGACGCGCCGGCTGGATGCGCCGCAGATCCATGACTGGCTGCTGCG
TTGGTTCAATCCCCGGCCCACCATGCTCGGGCCGACGGCGCAGGATCGCGAACGCTTCTACCGGCTGGCG
GCCTATCCGGAGGCACCGGAATCTGATGAGATCGAACTCGCCAGCGGCAAGGATTTCTCGCAGAGGTTGT
TCTTCGGCCAGCCGCGCTCCGACGCCGAGCTGGGGTTGTGGTACTTCGATAGCCTGCCGCACCGGGTCAT
GGTCACCGACCGCCTGCGCATGCCGCCGGCCACCGGCCATCTCACCGGCGAAACGCGTAAGGGCGACGCG
ATCAACACGCTGTTCGACCAGCTGCCCGAAGGCACCGTGATGTGCCTGACGCTGGTTGCGACGCCGCAGG
ACATCCTGGAAGCGCACCTCAACCAACTGGCGAAGAAGTCAGTCGGAGAAACCCTGGCGTCCGAGCAGGC
GCTCCAGGACGTGCAGGAGGCGCGTTCGCTGATCGGCAGCTCTCACAAGCTGTATCGCGGCTCGCTGGCG
TTCTACCTCTCCGGCGACGACGAAGACGAACTGGACCGGCGCGGCCTGCAGCTCGCCAACGTGATGCTCA
ACGCCGGGCTGCAGCCAGTCCGCGAAGAAGACGAAGTCGCGCCGCTCAACAGCTATCTGCGCTGGCTGCC
TTGCGTCTACAACCCCGGCGCGGACCGCAAGCAGTGGTACACGCAACTGATGTTCGCTCAGCATGCCGCC
AATCTGTCGCCGGCATGGGGACGCAGCCAGGGTACGGGCAGGCCCGGCATCACGCTGTTCAATCGCGGTG
GCGGAGTACTGACGTTCGACCCGTTCAGCAGATTGGATCGGCAAATGAATGCCCATTTGTTTTTGTTTGG
GCCAACGGGTTCGGGCAAGTCGGCCACGCTTAACAACATCCTCAACCAGGTCGCCGCGATCTACCGCCCG
CGCATGTTCATCGTGGAGGCCGGTAATTCCTTTGGCTTGCTGGCTGATTTCGCCGCACGGCTGGGCCTGT
CGGTGAACCGGGTCAAGCTCGCGCCCGGTTCGGGCGTGAGCCTCGCGCCGTTCGCCGATGCCCGCCGGTT
GATCGAATCCCCCAGTGATGTGCAGACGCTGGACGCCGATGCGCTGGATGAGGAACAGCCTGTCGACCCG
GCCGCCGTCGATACGGACGAGCAGCGCGATGTGCTCGGCGAGCTTGAGATCACCGCACGCTTGATGATCA
CGGGCGGCGAAGATAAAGAGGAATCCCGCATGACGCGGGCCGACCGCTCCTTGATCCGCCAGTGCATCCT
GGACGCCGCCCGCCACTGCGTCGCGCAAGACCGGGATGTGCTCACGCGCGACGTGCGCGACGCCCTACGC
GAGCGCGGCCGCGATTCGACCCTGCCCGAAACCCGTCGCACGCGGTTGTTGGAGATGGCTGACGCTATGG
ACATCTTCACGCAAGGCTCAGACGGCGAAATGTTCGACCGCCCCGGCACGCCCTGGCCAGAAGCCGACAT
CACGGTCGTCGATCTCGCCACCTATGCCAGGGAGGGCTACAACGCCCAGCTCTCGATCGCCTACATCTCC
CTGATCAATACCGTCAACAACATTGCGGAACGCGACCAGTTTCTCGGTCGGCCAATCCTCAACGTGACCG
ATGAAGGCCACATCATCACGCGCAATCCCTTGTTGTCTCCGTACGTGGTGAAGATCACCAAGATGTGGAG
AAAATTGGGCGCCTGGTATTGGTTGGCAACGCAGAACATCGACGATCTGCCCAGGGCGGCGGAGCCGATG
CTCAATATGATCGAGTGGTGGTTGTGCTTGTCGATGCCACCGGACGAAGTCGAAAAAATTGCCAGGTTCC
GCGAGTTGTCGCCAGCGCAGAAGGCACTGATGCTCTCGGCCAGGAAGGAATCCGGGAAGTTCAGCGAGGG
CGTCATTCTCTCCAAGAGCATGGAGGTGCTGTTCAGGGCCGTACCACCGAGCTTGTATCTCGCACTGGCC
CAGACCGAACCCGAAGAGAAAGCCGAACGATACCGGCTCATGCAACAGTTCGGCATCAACGAGCTGGAAG
CCGCGCTCAAGGTATCCGAGAACATCGACCGCGCGCGCGGCATCGAGCCGTTGCCATACGCCGATCTGCT
CTCCTGA
 Primer design