SecReT4
Protein ID: 237809188
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2447
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2671713..2672213 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDC4L9T9
KEGG IDtau:Tola_2447
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 8.6e-37, Aligned region: 52..163
Protein Sequence: 166 a.a.     [Download]
>gi|237809188|ref|YP_002893628.1| hypothetical protein Tola_2447 [Tolumonas auensis DSM 9187]
MRIVRGGHLHHGFDYQGHSPRDAKSMHTFLAHLSRTLALPALLLVAGNVTAAEIWIVADVRHPVAGAQAA
DRIIQLDAAQAIEAELSARLPDDPQRAAALVQRRLNEGGQALQQRMREAYQGMTDAWSLGITSIPAVIVD
QRYVVYGESDLGQALVRIERYREGQP
 
Nucleotide Sequence: 501 bp     [Download]
>ref|NC_012691.1|:2671713-2672213 hypothetical protein Tola_2447 [Tolumonas auensis DSM 9187]
GTGCGCATTGTTCGTGGTGGGCATCTGCACCATGGGTTCGACTACCAGGGTCATTCACCCCGAGACGCGA
AGTCCATGCACACCTTTCTTGCCCACCTCAGCCGGACGCTGGCCCTTCCGGCACTGCTGCTGGTCGCCGG
CAACGTGACCGCAGCGGAGATCTGGATCGTGGCGGACGTCCGCCACCCGGTGGCCGGTGCCCAGGCGGCG
GATCGCATCATCCAGCTCGACGCGGCGCAGGCCATCGAAGCGGAACTGTCGGCCCGGTTGCCGGACGATC
CGCAGCGGGCCGCGGCGCTCGTCCAGCGGCGGCTGAACGAAGGTGGCCAAGCGCTGCAACAGCGCATGCG
TGAGGCTTACCAGGGCATGACCGATGCCTGGAGCTTAGGCATCACCAGCATTCCGGCGGTGATCGTCGAT
CAGCGCTACGTCGTGTATGGGGAAAGCGACCTCGGCCAGGCGCTGGTCCGCATCGAGCGTTACCGGGAGG
GACAGCCATGA
 Primer design