SecReT4
Protein ID: 237809189
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2448
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2672210..2673142 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDC4L9U0
KEGG IDtau:Tola_2448
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5.6e-95, Aligned region: 28..298
Protein Sequence: 310 a.a.     [Download]
>gi|237809189|ref|YP_002893629.1| hypothetical protein Tola_2448 [Tolumonas auensis DSM 9187]
MISRRLRLGAAVALLCSATSSFALNTATIISSTLSPDCLEYRVTGICYWLYCTWTGCTVRTSIKVRHYVP
DAVVSSYSNTGENPWVEARAMSQPNATAQAGGDGTTNEDHENNLAKFKNADVIGHPGGEVFSQFASASGY
ICAGAGTAFMPYLLSTLDTLAWRYNVPEAVYPEALIPGMREIGTRSGLNLWGAVYPRGGFLHQTDDYKAG
AVVAQRAGDIVTRRGQLHVYQPLLANARDGYWPAGALIESDASTGKWQQLTPRLSNSCTVFPHAGSLPQA
QRGDYAWALWRPYSCCQRRGQTFLGSVDFN
 
Nucleotide Sequence: 933 bp     [Download]
>ref|NC_012691.1|:2672210-2673142 hypothetical protein Tola_2448 [Tolumonas auensis DSM 9187]
ATGATTTCCCGTCGCCTGCGGCTCGGGGCCGCCGTCGCGCTGCTGTGCAGTGCCACGTCGAGCTTCGCCC
TCAACACCGCCACCATCATCTCCTCGACCTTGTCGCCGGACTGCCTCGAATACCGGGTCACCGGGATCTG
CTACTGGCTGTATTGCACCTGGACGGGCTGCACCGTGCGCACGTCGATCAAGGTACGCCACTACGTTCCC
GACGCGGTGGTATCGAGCTACAGCAACACCGGGGAGAATCCCTGGGTCGAGGCGCGGGCAATGAGCCAGC
CCAATGCCACGGCGCAGGCCGGTGGTGACGGAACCACCAACGAGGATCACGAAAACAATCTTGCAAAGTT
CAAGAACGCCGACGTCATCGGCCACCCGGGCGGCGAGGTATTCAGCCAGTTCGCTTCGGCGTCCGGCTAC
ATCTGCGCAGGCGCCGGTACTGCCTTCATGCCGTACCTGCTCAGCACGCTCGACACCCTGGCCTGGCGCT
ACAACGTCCCGGAGGCGGTGTACCCCGAGGCGCTGATCCCCGGTATGCGCGAGATCGGCACACGCAGCGG
ACTGAATCTTTGGGGCGCCGTGTACCCGCGTGGCGGGTTCTTGCACCAGACCGACGACTACAAGGCCGGG
GCGGTCGTCGCCCAGCGTGCTGGCGACATCGTGACCCGCCGCGGCCAACTGCATGTGTACCAGCCGCTGC
TGGCGAACGCGCGCGACGGCTACTGGCCGGCCGGCGCGTTGATCGAAAGCGACGCCAGCACGGGCAAGTG
GCAGCAACTGACCCCACGCCTTTCCAACAGCTGCACCGTGTTTCCCCATGCCGGGTCGCTGCCCCAGGCA
CAACGGGGCGACTACGCCTGGGCGCTGTGGCGCCCGTACAGCTGCTGCCAGCGCCGCGGGCAGACCTTCC
TTGGCAGTGTGGATTTCAACTGA
 Primer design