SecReT4
Protein ID: 237809190
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2449
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2673153..2674550 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDC4L9U1
KEGG IDtau:Tola_2449
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 465 a.a.     [Download]
>gi|237809190|ref|YP_002893630.1| hypothetical protein Tola_2449 [Tolumonas auensis DSM 9187]
MKRPDRRRHSMLADHLWRPAILAGALALASGWAWAQSGGFQTSGSVIGDEVMYSIGGGNAVSMSGAAGMR
SIGVGAGWNSNLICGDMSISTTIQNQLNGLTNGFQNIMSNVIQSATSAVASLPALIIQRADPGLYNLLTN
GVLQARLDFDRSKLTCRSMAERMADMAGGQLGWSQMAEGMALRDAVSSTDAVSAIEQAETRRGNDGVPWV
GGNNAGGAGQPAIRVVSDVTRAGYNLVNGRSVTDASAIDAASCNSLACQTWTSPQEAIDWATRVLGEQEQ
RTCDACTKTETVPGVGLTPLIQEEYDTKLQTLQELIDGTRNTTFENLRDAGSVSLPITRGVIEALRDEPD
QHVLAQRLASEVALASVLEKALLLQRTLLTGRKEPNVAANQLAVAAVDQESGALDREISNLKTELELRRT
LANNSPMAIIQRHSTRAAGSRGIYEGDPVPDRLDQLQRPNPGGTP
 
Nucleotide Sequence: 1398 bp     [Download]
>ref|NC_012691.1|:2673153-2674550 hypothetical protein Tola_2449 [Tolumonas auensis DSM 9187]
ATGAAGCGCCCTGACCGTCGCCGTCATTCCATGCTTGCAGATCACTTGTGGCGGCCGGCCATACTGGCCG
GCGCGCTCGCGTTGGCCAGTGGCTGGGCATGGGCTCAGAGCGGCGGCTTCCAGACCAGCGGCAGCGTGAT
CGGCGACGAAGTCATGTACTCGATCGGTGGCGGTAACGCGGTTTCCATGAGCGGCGCTGCGGGCATGCGC
TCGATCGGGGTCGGGGCCGGCTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCAGCACCACGATCC
AGAACCAGCTCAACGGGCTGACCAACGGATTTCAAAACATCATGAGCAACGTGATCCAGAGCGCTACCAG
CGCCGTTGCGTCGCTTCCGGCTCTGATCATCCAGAGGGCCGACCCAGGTTTGTATAACCTGCTGACCAAT
GGCGTCCTCCAGGCAAGGCTGGATTTCGATCGCTCCAAGTTGACCTGCAGGTCGATGGCTGAACGCATGG
CCGACATGGCCGGCGGCCAGCTTGGCTGGAGCCAGATGGCGGAAGGCATGGCGCTGCGCGATGCCGTGTC
GAGCACGGATGCGGTGTCGGCCATTGAGCAGGCTGAGACGCGCCGGGGCAACGACGGCGTGCCGTGGGTC
GGGGGCAACAACGCCGGCGGCGCCGGTCAGCCGGCGATCAGGGTGGTGAGCGACGTTACCAGGGCCGGCT
ACAACCTCGTCAATGGCCGCAGCGTGACCGACGCCTCGGCCATCGATGCGGCGAGCTGCAACAGCCTGGC
CTGCCAGACCTGGACCTCCCCGCAAGAAGCGATCGACTGGGCCACCCGCGTGCTCGGCGAACAGGAGCAG
CGCACCTGCGACGCCTGCACCAAAACCGAAACCGTTCCGGGTGTGGGCCTGACACCCCTCATCCAGGAAG
AGTACGACACCAAGCTGCAGACGCTGCAGGAGCTGATCGACGGCACACGCAACACCACCTTCGAGAACCT
GCGCGACGCCGGCAGCGTGTCACTGCCGATCACCCGGGGCGTCATCGAGGCACTGCGCGACGAACCGGAC
CAACACGTCCTGGCGCAACGTCTTGCCTCGGAAGTCGCCTTGGCATCGGTGCTGGAGAAAGCCTTGCTGC
TGCAGCGCACCCTGCTGACCGGCAGGAAGGAGCCCAACGTCGCTGCCAACCAGTTGGCGGTGGCTGCCGT
CGATCAGGAGAGCGGCGCGCTCGACCGGGAGATCTCGAACCTCAAGACTGAACTGGAGCTGCGCCGCACG
CTCGCCAACAACTCGCCGATGGCGATCATCCAGCGCCACAGCACCCGGGCCGCCGGTTCGCGGGGCATCT
ACGAGGGCGACCCCGTACCCGACCGCCTCGACCAGCTGCAGCGGCCCAACCCGGGAGGTACGCCATGA
 Primer design