SecReT4
Protein ID: 237809192
T4SS name [ID]Tfc [716]
Gene symbol-
Locus tagTola_2451
StrainTolumonas auensis DSM 9187
Repliconchromosome [GenBank: NC_012691] [Browse all T4SS(s) in this replicon]
Location [Strand]2674911..2676431 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDC4L9U3
KEGG IDtau:Tola_2451
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.6e-132, Aligned region: 10..490
Protein Sequence: 506 a.a.     [Download]
>gi|237809192|ref|YP_002893632.1| hypothetical protein Tola_2451 [Tolumonas auensis DSM 9187]
MTLFTTDYLEYYLTLLGWIIHNGIWAVLVSSGVFAIPFVAIIIQEWLKARAEGADEGNKGALSSVRIENR
VWVAIVVVMFAGIPFIDVDLNTIQYDQARSAQCQVSVPQPSDTGWSQSFSTLNNQSARVPVWWAFMHALS
RAITGASVAAIPCGTDLRQIRMEVNATRIDDPVLAQEVADFTHDCYGPARAKLFMSRPDLDEAQMHDVTW
IGSRYFLDNAGYYDTYRARTPRDGWAYDSNRDAGLAQVPSGAGYPTCRQWWSDSGNGLRARLLEQVDPSL
LNRLAGWAGFLSRAEVDDSVIRTIASPRQQKLNQGSVYTDYGGQIDKTLPNIINRAASDVGMAVGGLAYF
PAMDVVRQALPMVLAFLKMALVICIPMVLLIGTYDLKTVVTLTVVQFALFFTDFWLQLARWIDSTILDAL
YGWGWGWNRPHTNFDPLIGLNNTFGDMLLNFVMGAMFLVLPGFWVAALGWVGFRAGHTIQGMAEGTKGGA
QAGGKGAGAMTGGKLK
 
Nucleotide Sequence: 1521 bp     [Download]
>ref|NC_012691.1|:2674911-2676431 hypothetical protein Tola_2451 [Tolumonas auensis DSM 9187]
ATGACGTTGTTCACCACGGATTACCTGGAGTATTACCTGACCCTGCTGGGCTGGATCATCCATAACGGCA
TCTGGGCGGTTCTCGTTTCCAGCGGCGTGTTCGCCATTCCCTTCGTGGCGATCATCATCCAGGAATGGCT
CAAGGCGCGTGCCGAGGGTGCGGACGAAGGCAATAAAGGCGCACTGTCATCGGTACGCATCGAGAACCGC
GTCTGGGTGGCGATCGTCGTGGTGATGTTCGCCGGTATTCCCTTCATCGACGTCGACCTCAACACCATCC
AGTACGACCAGGCACGCTCGGCGCAGTGCCAGGTGAGCGTTCCCCAGCCCAGCGATACTGGCTGGTCGCA
GTCGTTCAGCACGCTCAACAACCAGAGCGCGCGCGTGCCGGTGTGGTGGGCCTTCATGCACGCGCTGTCG
CGCGCGATCACCGGCGCCTCGGTCGCCGCCATTCCGTGCGGAACCGACCTGCGGCAGATCCGCATGGAGG
TCAATGCCACACGCATCGACGACCCCGTATTGGCACAGGAAGTCGCCGACTTCACCCACGACTGTTATGG
CCCTGCACGCGCCAAGCTGTTCATGAGCCGCCCGGATCTCGACGAGGCGCAGATGCACGACGTCACCTGG
ATCGGGTCTCGGTACTTCCTCGACAATGCGGGCTACTACGACACCTACCGGGCCAGGACGCCGCGCGACG
GCTGGGCCTACGACAGCAACCGCGATGCCGGCCTGGCACAGGTGCCGAGCGGTGCCGGCTATCCGACCTG
CCGCCAGTGGTGGAGCGACAGTGGCAACGGCCTGCGCGCCCGCCTGCTGGAGCAGGTCGATCCCAGCCTG
CTCAACCGTCTGGCCGGCTGGGCCGGTTTCCTCAGCCGTGCCGAGGTTGATGACTCGGTGATCCGCACTA
TCGCCTCGCCGCGCCAGCAGAAGCTTAACCAGGGCAGCGTCTATACCGATTATGGCGGGCAGATTGATAA
GACGCTGCCCAACATCATCAATCGCGCCGCCAGTGACGTCGGGATGGCGGTTGGTGGACTCGCCTATTTC
CCGGCAATGGACGTCGTGCGCCAAGCCTTACCCATGGTGCTGGCGTTCCTGAAAATGGCTTTGGTGATCT
GTATTCCGATGGTATTGCTGATCGGCACCTACGACCTGAAAACCGTCGTCACTCTTACCGTCGTCCAGTT
TGCGTTGTTCTTCACCGATTTCTGGCTGCAACTGGCGCGCTGGATCGACAGCACGATCCTCGATGCGCTT
TACGGTTGGGGATGGGGATGGAACCGCCCCCACACGAATTTTGACCCTCTGATTGGGCTGAACAACACGT
TTGGCGACATGCTGCTGAACTTCGTGATGGGAGCCATGTTCCTGGTGTTACCCGGGTTCTGGGTCGCGGC
GCTGGGATGGGTCGGTTTTCGCGCAGGGCATACCATTCAAGGCATGGCCGAAGGCACCAAGGGAGGCGCA
CAGGCTGGTGGCAAAGGCGCAGGTGCCATGACGGGTGGAAAACTCAAGTAG
 Primer design