SecReT4
Protein ID: 237809984
T4SS name [ID]Tra_F [582]
Gene symboltraL
Locus tagpAR060302_0077
StrainEscherichia coli plasmid pAR060302 (NC_012692)
Repliconplasmid pAR060302 [GenBank: NC_012692] [Browse all T4SS(s) in this replicon]
Location [Strand]56463..56744 [+]
ProductTraL
Component typeTraL_F
UniProt IDC4NVT5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-15, Aligned region: 4..80
Protein Sequence: 93 a.a.     [Download]
>gi|237809984|ref|YP_002894423.1| TraL [Escherichia coli]
MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVIIGKALICFLGGLLVTNLYRRFRDNHPDGYLLHMI
YWAGFIMTKAKSLKNPFVRRYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|237809907|ref|NC_012692.1|:56463-56744 Escherichia coli plasmid pAR060302, complete sequence
ATGAAGCCTGTAAAGATACCGCGCCGGGTCGATGAGCCCCCGCATCTGCTGTTGTGGAGCGCAGATGAGT
TGGCCCCGATGCTTTTGGGGCTAACGATAGGGGTCATCATCGGTAAGGCTCTGATCTGCTTTCTGGGGGG
GTTACTTGTAACCAACCTTTATCGCCGATTCAGGGATAACCATCCGGATGGATACCTGCTCCACATGATC
TACTGGGCCGGGTTCATCATGACCAAGGCCAAATCTCTCAAGAACCCGTTTGTCCGGAGGTATTTGCCTT
GA
 Primer design