SecReT4
Protein ID: 237810086
T4SS name [ID]Tra_F [582]
Gene symboltraF
Locus tagpAR060302_0180
StrainEscherichia coli plasmid pAR060302 (NC_012692)
Repliconplasmid pAR060302 [GenBank: NC_012692] [Browse all T4SS(s) in this replicon]
Location [Strand]155402..156430 [+]
ProductTraF
Component typeTraF_F
UniProt IDC4NV63
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.9e-68, Aligned region: 43..272
Protein Sequence: 342 a.a.     [Download]
>gi|237810086|ref|YP_002894526.1| TraF [Escherichia coli]
MRETMKKSPLNLLLLAALTLGASHQAWAQDGTRPGFYERKEEGWFWYKEEPKEPEKKPEKPKPKPVAEAK
PTQPKPAAPLPSGPEMFSAEWFRENLPKYKDLAWNNPTVENVRTFLYLQRFAIDRSEQFSDATELAVVGD
PFLDEITRRPAATFASQQVDRDAGNAKNMLLKSVAERVGIFFFYKSDDDYSDLQAPLIKMLEQGEGFSII
PVSMDGKPLPSGLFPHYKTDEGHAKQLGIVTFPAVYLASPDGQFAPIGQGPMSLPELNHRILVAAKRNGW
VTDEEFNRTRPVLNLENNIAERLASPELGSDLKQLSQASGDKDNFVPPEQLMKYIRDKLQEN
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|237809907|ref|NC_012692.1|:155402-156430 Escherichia coli plasmid pAR060302, complete sequence
GTGCGTGAGACTATGAAAAAATCACCTTTGAATTTACTGCTCCTTGCAGCGCTCACGCTGGGGGCATCAC
ACCAGGCTTGGGCTCAAGATGGCACAAGACCTGGTTTTTATGAGCGAAAGGAAGAGGGTTGGTTCTGGTA
CAAGGAAGAGCCCAAAGAACCAGAGAAAAAACCCGAAAAGCCCAAACCAAAGCCTGTGGCAGAAGCGAAG
CCTACACAGCCTAAGCCTGCTGCTCCGCTTCCGAGCGGCCCAGAAATGTTCTCAGCGGAATGGTTCCGGG
AAAACTTACCCAAGTACAAAGACCTTGCTTGGAACAATCCTACCGTTGAAAACGTCAGGACGTTTCTCTA
CTTGCAACGATTTGCGATAGATCGCTCTGAACAATTTTCCGATGCTACAGAGCTGGCGGTCGTAGGTGAT
CCTTTCTTGGATGAAATTACTCGACGTCCTGCTGCCACGTTTGCCTCACAACAAGTTGATCGTGACGCTG
GTAACGCCAAAAACATGCTACTCAAAAGCGTAGCCGAACGCGTAGGGATATTCTTCTTCTACAAGTCCGA
CGATGACTACAGTGACTTGCAAGCACCGCTCATCAAGATGTTGGAACAAGGAGAAGGATTCTCGATCATT
CCTGTATCTATGGACGGCAAACCACTCCCCAGTGGGCTTTTCCCCCATTACAAAACCGATGAAGGCCATG
CCAAACAACTTGGTATCGTAACTTTCCCTGCTGTTTACCTCGCATCTCCAGACGGTCAGTTCGCTCCTAT
AGGACAAGGGCCAATGTCTCTTCCTGAGCTGAATCACAGGATTTTGGTCGCAGCAAAACGCAATGGTTGG
GTCACAGACGAAGAGTTTAACCGTACACGTCCGGTACTCAACCTGGAAAACAACATAGCCGAACGCTTGG
CCTCACCAGAGCTGGGCTCTGACCTCAAACAGCTATCTCAAGCGAGCGGTGATAAAGACAACTTTGTGCC
ACCGGAACAACTCATGAAGTACATCCGGGACAAATTACAGGAGAACTAA
 Primer design