SecReT4
Protein ID: 237810172
T4SS name [ID]Tra_F [581]
Gene symboltraL
Locus tagpAM04528_0075
StrainSalmonella enterica plasmid pAM04528 (NC_012693)
Repliconplasmid pAM04528 [GenBank: NC_012693] [Browse all T4SS(s) in this replicon]
Location [Strand]54775..55056 [+]
ProductTraL
Component typeTraL_F
UniProt IDC4NVE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-15, Aligned region: 4..80
Protein Sequence: 93 a.a.     [Download]
>gi|237810172|ref|YP_002894611.1| TraL [Salmonella enterica]
MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVIIGKALICFLGGLLVTNLYRRFRDNHPDGYLLHMI
YWAGFIMTKAKSLKNPFVRRYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|237810097|ref|NC_012693.1|:54775-55056 Salmonella enterica plasmid pAM04528, complete sequence
ATGAAGCCTGTAAAGATACCGCGCCGGGTCGATGAGCCCCCGCATCTGCTGTTGTGGAGCGCAGATGAGT
TGGCCCCGATGCTTTTGGGGCTAACGATAGGGGTCATCATCGGTAAGGCTCTGATCTGCTTTCTGGGGGG
GTTACTTGTAACCAACCTTTATCGCCGATTCAGGGATAACCATCCGGATGGATACCTGCTCCACATGATC
TACTGGGCCGGGTTCATCATGACCAAGGCCAAATCTCTCAAGAACCCGTTTGTCCGGAGGTATTTGCCTT
GA
 Primer design