SecReT4
Protein ID: 237810266
T4SS name [ID]Tra_F [581]
Gene symboltraF
Locus tagpAM04528_0169
StrainSalmonella enterica plasmid pAM04528 (NC_012693)
Repliconplasmid pAM04528 [GenBank: NC_012693] [Browse all T4SS(s) in this replicon]
Location [Strand]147086..148114 [+]
ProductTraF
Component typeTraF_F
UniProt IDC4NVP2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.9e-68, Aligned region: 43..272
Protein Sequence: 342 a.a.     [Download]
>gi|237810266|ref|YP_002894705.1| TraF [Salmonella enterica]
MRETMKKSPLNLLLLAALTLGASHQAWAQDGTRPGFYERKEEGWFWYKEEPKEPEKKPEKPKPKPVAEAK
PTQPKPAAPLPSGPEMFSAEWFRENLPKYKDLAWNNPTVENVRTFLYLQRFAIDRSEQFSDATELAVVGD
PFLDEITRRPAATFASQQVDRDAGNAKNMLLKSVAERVGIFFFYKSDDDYSDLQAPLIKMLEQGEGFSII
PVSMDGKPLPSGLFPHYKTDEGHAKQLGIVTFPAVYLASPDGQFAPIGQGPMSLPELNHRILVAAKRNGW
VTDEEFNRTRPVLNLENNIAERLASPELGSDLKQLSQASGDKDNFVPPEQLMKYIRDKLQEN
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|237810097|ref|NC_012693.1|:147086-148114 Salmonella enterica plasmid pAM04528, complete sequence
GTGCGTGAGACTATGAAAAAATCACCTTTGAATTTACTGCTCCTTGCAGCGCTCACGCTGGGGGCATCAC
ACCAGGCTTGGGCTCAAGATGGCACAAGACCTGGTTTTTATGAGCGAAAGGAAGAGGGTTGGTTCTGGTA
CAAGGAAGAGCCCAAAGAACCAGAGAAAAAACCCGAAAAGCCCAAACCAAAGCCTGTGGCAGAAGCGAAG
CCTACACAGCCTAAGCCTGCTGCTCCGCTTCCGAGCGGCCCAGAAATGTTCTCAGCGGAATGGTTCCGGG
AAAACTTACCCAAGTACAAAGACCTTGCTTGGAACAATCCTACCGTTGAAAACGTCAGGACGTTTCTCTA
CTTGCAACGATTTGCGATAGATCGCTCTGAACAATTTTCCGATGCTACAGAGCTGGCGGTCGTAGGTGAT
CCTTTCTTGGATGAAATTACTCGACGTCCTGCTGCCACGTTTGCCTCACAACAAGTTGATCGTGACGCTG
GTAACGCCAAAAACATGCTACTCAAAAGCGTAGCCGAACGCGTAGGGATATTCTTCTTCTACAAGTCCGA
CGATGACTACAGTGACTTGCAAGCACCGCTCATCAAGATGTTGGAACAAGGAGAAGGATTCTCGATCATT
CCTGTATCTATGGACGGCAAACCACTCCCCAGTGGGCTTTTCCCCCATTACAAAACCGATGAAGGCCATG
CCAAACAACTTGGTATCGTAACTTTCCCTGCTGTTTACCTCGCATCTCCAGACGGTCAGTTCGCTCCTAT
AGGACAAGGGCCAATGTCTCTTCCTGAGCTGAATCACAGGATTTTGGTCGCAGCAAAACGCAATGGTTGG
GTCACAGACGAAGAGTTTAACCGTACACGTCCGGTACTCAACCTGGAAAACAACATAGCCGAACGCTTGG
CCTCACCAGAGCTGGGCTCTGACCTCAAACAGCTATCTCAAGCGAGCGGTGATAAAGACAACTTTGTGCC
ACCGGAACAACTCATGAAGTACATCCGGGACAAATTACAGGAGAACTAA
 Primer design