SecReT4
Protein ID: 237811232
T4SS name [ID]Trb [479]
Gene symbol-
Locus tagGBP346_A0959
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]920942..921529 [+]
Producttraf peptidase, serine peptidase, merops family s26c
Component typeTraF
UniProt IDC4KSF1
KEGG IDbpr:GBP346_A0959
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 4e-56, Aligned region: 46..191
Protein Sequence: 195 a.a.     [Download]
>gi|237811232|ref|YP_002895683.1| traf peptidase, serine peptidase, merops family s26c [Burkholderia pseudomallei MSHR346]
MTVTTASLSRSPAHSRLRARLVLACLSACGLVALAWASFVHPLPRLTYNPSDSVAVGWYRVDPLDHRTSS
PPRPLPVGSIVLVPLPAEAAALAAQRGYLPTRIPLLKRVGAVAPQEVCIADGRVRIDGVPSAAVLPTDRW
GRPLPSWQQCRRLRPGELFLLSVTNPASFDSRYFGPISAAAVIGIARPVWLESRP
 
Nucleotide Sequence: 588 bp     [Download]
>gi|237810278|ref|NC_012695.1|:920942-921529 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGACGGTCACAACAGCATCACTTTCTCGCTCGCCTGCGCACTCACGTTTGCGCGCTCGCCTCGTGCTGG
CGTGCCTGTCCGCCTGCGGCCTCGTTGCGCTGGCCTGGGCGTCCTTCGTGCATCCACTGCCGCGCCTGAC
CTACAACCCGTCCGACAGCGTTGCGGTCGGCTGGTATCGTGTCGATCCGCTCGACCATCGCACCAGCTCG
CCGCCACGTCCGTTGCCCGTAGGCAGCATCGTGCTGGTGCCGCTGCCCGCCGAGGCTGCCGCGCTCGCTG
CGCAGCGCGGCTACCTGCCGACGCGCATCCCGTTGCTCAAGCGCGTAGGCGCGGTGGCGCCGCAAGAGGT
GTGCATCGCTGACGGCAGAGTCCGCATCGACGGCGTGCCTTCGGCCGCTGTGCTGCCTACCGATCGCTGG
GGACGGCCGCTGCCATCCTGGCAGCAGTGCCGGCGCCTTCGGCCTGGCGAACTGTTCCTGCTCAGCGTCA
CCAATCCGGCGTCGTTCGACAGCCGCTACTTCGGGCCGATCAGCGCCGCCGCCGTGATCGGCATTGCGCG
CCCGGTCTGGCTGGAGTCACGCCCATGA
 Primer design