SecReT4
Protein ID: 237811241
T4SS name [ID]Trb [479]
Gene symbol-
Locus tagGBP346_A0968
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]933772..935775 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDC4KSG0
KEGG IDbpr:GBP346_A0968
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 6.7e-102, Aligned region: 117..562
TraG-D_C [PF12696], Evalue: 4e-29, Aligned region: 403..524
TrwB_AAD_bind [PF10412], Evalue: 1.2e-28, Aligned region: 171..539
Protein Sequence: 667 a.a.     [Download]
>gi|237811241|ref|YP_002895692.1| conjugal transfer coupling protein TraG [Burkholderia pseudomallei MSHR346]
MRAQGVLFGQVATVSGIVIAGVWGATQWTAAALGHQARLGLPWLNVFDTPVYYPWQLFEWWFFYDAYAPR
VFDMGGAIAGGSGLAAAGAAMAMSVWRSRQSKRVTTYGSARWAEAADIRKAGLDQPAGVFLGLHRGQYLR
HDGPEHVLTFAPTRSGKGVGLVIPTLLSWPASAVIHDIKGENWQITAGWRARFSHCLLFNPADPKSAAYN
PLLEVRRGAHEVRDVQNIADILVDPEGALERRNHWEKTSHALLVGAILHVLYAGEDKTLRGVTNFLSDPV
CPFELTLHRMMTTRHLGDAPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIA
DLIASEYPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGTDGIARKHRLLLMLDEFPALGRLDFF
ESALAFMAGYGLRAFLIAQSLNQIDRAYGQNHSILDHCHVRVTFATNDERTAKRISETLGTSTELRAQRN
YAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDDALVMVSSVAPIKAKKLRYYADANFKQRVLPPPA
LSAGRYADVPPLRPDDWRGLAIPAVPAVRAASTDWPDSDTATTADDGGPRRQPELSGVTSGGPEHAPLAN
DLALLDDDDLSLPSQLDPAMQRNALLASLDQPDGIER
 
Nucleotide Sequence: 2004 bp     [Download]
>gi|237810278|ref|NC_012695.1|:933772-935775 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGCGAGCTCAAGGTGTGCTGTTTGGTCAAGTCGCCACGGTGTCTGGCATCGTGATCGCTGGCGTGTGGG
GCGCTACGCAATGGACGGCCGCCGCACTGGGCCATCAGGCGCGACTCGGCTTGCCCTGGCTCAATGTCTT
CGACACGCCGGTCTATTACCCCTGGCAGCTCTTCGAGTGGTGGTTCTTCTATGACGCCTACGCGCCACGC
GTTTTTGACATGGGGGGCGCGATCGCGGGAGGCAGCGGCCTAGCGGCCGCAGGGGCCGCCATGGCGATGT
CGGTCTGGCGATCGCGTCAATCGAAGCGGGTCACAACCTATGGGTCGGCGCGCTGGGCCGAAGCTGCCGA
CATTCGCAAAGCCGGCCTCGACCAGCCGGCCGGTGTATTCCTCGGCCTGCATCGCGGCCAGTATCTTCGC
CATGACGGCCCGGAACACGTTCTGACGTTTGCACCAACGCGCTCTGGCAAGGGCGTCGGCCTGGTCATAC
CCACATTGTTGAGTTGGCCGGCGTCGGCTGTTATCCACGACATCAAGGGGGAGAACTGGCAGATCACTGC
TGGCTGGCGCGCCCGCTTTTCGCACTGCCTTCTGTTCAACCCCGCCGATCCAAAGTCGGCTGCATACAAT
CCGTTGCTGGAAGTCCGGCGCGGGGCACATGAAGTGCGCGATGTGCAGAACATCGCCGACATTCTGGTCG
ATCCAGAAGGTGCACTGGAGAGGCGCAACCATTGGGAAAAAACCTCGCACGCGCTATTGGTCGGCGCCAT
CCTGCACGTGCTCTATGCGGGCGAAGACAAGACGCTGCGCGGCGTTACCAACTTCCTGTCCGATCCCGTG
TGCCCGTTCGAGCTGACGCTGCACCGGATGATGACCACACGGCATCTCGGTGATGCGCCGCATCCGGTAG
TGGCCTCCGCTGCGCGCGAGGTGCTTAACAAAAGCGACAACGAGCGCTCCGGCGTATTGTCGACCGCCAT
GTCGTTTCTCGGCCTGTACCGCGATCCCACGGTGGCGGAGGTCACCTCGCGCTGTGATTGGCGCATCGCC
GACCTGATCGCATCCGAATACCCGGTGTCTTTGTATCTGGTGGTGCCGCCCTCGGACATCAGCCGCACCA
AGCCGTTGATCCGGCTAATCCTCAATCAGATCGGGCGGCGACTCACGGAGTCGCTTGACGGCACGGACGG
CATCGCGCGCAAGCACCGGCTGCTGTTGATGCTCGACGAGTTTCCTGCGCTGGGCCGCTTGGATTTCTTC
GAGTCCGCGCTGGCCTTCATGGCGGGTTATGGCCTGCGGGCCTTCCTGATTGCGCAGTCGCTCAATCAGA
TCGATCGCGCCTACGGCCAGAACCATTCGATCCTCGACCACTGCCATGTGCGCGTGACGTTCGCCACCAA
CGACGAACGCACGGCCAAACGCATTTCCGAGACGCTGGGCACGTCGACCGAACTGCGCGCGCAGCGCAAC
TATGCGGGCCATCGGCTTGCGCCGTGGCTGGGCCACCTGATGGTCTCGCGGCAGGAGACGGCGCGCCCAC
TGCTCACGCCTGGCGAAGTGATGCAGCTCCCGCCGGATGATGCCCTCGTGATGGTGTCCAGCGTGGCACC
AATCAAGGCAAAAAAACTGCGCTACTACGCCGATGCCAATTTCAAGCAGCGCGTATTGCCGCCGCCTGCG
CTCTCGGCCGGACGCTACGCCGACGTACCACCTCTGCGCCCAGACGACTGGCGTGGCCTTGCTATCCCCG
CCGTACCGGCAGTTCGGGCCGCATCCACTGACTGGCCGGACAGCGACACTGCGACCACCGCCGACGACGG
CGGACCGCGCCGCCAGCCGGAGTTGTCCGGAGTCACCAGCGGCGGCCCGGAGCACGCACCATTGGCCAAC
GACTTGGCGCTGCTCGATGACGACGACCTGTCGCTTCCCAGTCAGCTCGATCCGGCCATGCAGCGCAACG
CCCTGCTGGCATCGCTCGACCAACCCGATGGGATCGAGCGATGA
 Primer design