SecReT4
Protein ID: 237811243
T4SS name [ID]Trb [479]
Gene symboltrbB
Locus tagGBP346_A0970
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]936233..937261 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDC4KSG2
KEGG IDbpr:GBP346_A0970
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.8e-80, Aligned region: 27..293
TrwB_AAD_bind [PF10412], Evalue: 3.7e-06, Aligned region: 149..186
FtsK_SpoIIIE [PF01580], Evalue: 9.1e-06, Aligned region: 147..218
Protein Sequence: 342 a.a.     [Download]
>gi|237811243|ref|YP_002895694.1| P-type conjugative transfer ATPase TrbB [Burkholderia pseudomallei MSHR346]
MTARPDSFVTTSLDRRIRMLRTAMGPLIAAALEDPDVVEIMLNPDRTLWVDRLSSGRAPLGATLSEEDGE
RIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKRAVGVIALERYVADGMMTVQQ
AAFLRRAVRERQNVLIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTIELQCVARDHVPLRTRAGVVSM
AELVRATMRLRPDRVIVGEVRGGEALDLIKVWGTGHPGGIATIHAGSELGALLRLEQLILEVAVNPPRAL
IAEAVNVVIYLAGRGKKRRIERIARVVGCDHASYHLTDALETPLPGLQPLDAPSSNDVGARP
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|237810278|ref|NC_012695.1|:936233-937261 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGACTGCACGACCCGATTCGTTTGTCACCACGTCCCTCGACCGGCGCATCCGCATGCTGCGCACGGCAA
TGGGGCCGCTGATCGCCGCCGCGCTGGAAGACCCGGACGTGGTGGAAATCATGCTCAACCCCGATCGGAC
GCTGTGGGTCGATCGCCTGTCTTCCGGTCGCGCGCCGCTGGGCGCGACACTTTCCGAGGAAGACGGCGAA
CGCATCATCCGCCTGGTAGCCGCGCATGTCGGCGCGGAAGTCCATCGCGGCCAGCCGCTACTAACGGCCG
AATTGCCCGAGACCGGCGAGCGCTTCGAGGGCATCCTGCCGCCGGCTGCTCCGGGACCGGCCTTTGCGCT
GCGCAAGCGTGCCGTGGGTGTCATTGCGCTGGAGCGCTACGTCGCCGACGGGATGATGACGGTGCAGCAG
GCTGCGTTCCTGCGTCGTGCCGTGCGCGAGCGGCAGAACGTCCTGATCGCGGGCGGCACCAGCACGGGCA
AGACCACGTTGGCCAATGCGCTGCTGGCGGAGATCGCCGCCACGGGCGATCGCGTGTTGGTGCTTGAGGA
CACGATTGAGCTGCAATGCGTCGCGCGCGACCACGTGCCACTGCGCACGCGCGCAGGCGTTGTGTCCATG
GCCGAACTGGTGCGCGCCACCATGCGCCTGCGGCCTGATCGGGTGATCGTCGGCGAGGTTCGCGGTGGCG
AGGCGCTGGATCTCATCAAGGTCTGGGGCACAGGCCATCCCGGCGGCATCGCCACCATTCACGCCGGCTC
GGAACTCGGGGCACTGCTGCGCCTGGAGCAACTGATTCTCGAAGTCGCGGTCAACCCACCGCGCGCGCTG
ATCGCCGAGGCGGTCAATGTTGTGATCTATCTCGCCGGTCGTGGCAAGAAGCGCCGCATCGAGCGCATCG
CTCGCGTTGTCGGCTGCGACCACGCGAGCTATCACCTGACCGATGCCCTGGAAACGCCGCTTCCCGGGTT
GCAGCCGCTTGACGCGCCATCCTCCAACGATGTTGGAGCACGGCCATGA
 Primer design