SecReT4
Protein ID: 237811244
T4SS name [ID]Trb [479]
Gene symbol-
Locus tagGBP346_A0971
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]937258..937632 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDC4KSG3
KEGG IDbpr:GBP346_A0971
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.2e-22, Aligned region: 34..114
Protein Sequence: 124 a.a.     [Download]
>gi|237811244|ref|YP_002895695.1| conjugal transfer protein TrbC [Burkholderia pseudomallei MSHR346]
MTQGHPLVLRGCVNPLARLWRFAGLGQGGLWLGGVLLSMAGPGRAAGSSMPWEGPLQSILESIQGPVARI
IAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 375 bp     [Download]
>gi|237810278|ref|NC_012695.1|:937258-937632 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGACGCAGGGTCACCCCCTTGTTTTGCGTGGTTGCGTTAATCCGCTTGCTCGCCTGTGGCGTTTCGCCG
GGCTGGGGCAGGGTGGGTTGTGGCTGGGCGGCGTGCTGTTGAGCATGGCCGGTCCCGGGAGGGCAGCAGG
TTCCTCGATGCCCTGGGAAGGTCCGCTGCAATCTATTCTCGAATCCATCCAGGGGCCGGTGGCACGCATT
ATCGCCGTCATCATCATCATTGCGACCGGACTCGCGCTTGCGTTCGGCGATACCAGTGGGGGCTTTCGCA
AGCTGATCCAGATCGTTTTCGGCCTGTCGATCGCCTTCGCGGCATCCTCGTTTTTCCTGTCTTTTTTTAG
CTTTTCCGGCGGAGCCGTCGTATGA
 Primer design