SecReT4
Protein ID: 237811245
T4SS name [ID]Trb [479]
Gene symbol-
Locus tagGBP346_A0972
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]937629..937898 [+]
Productconjugal transfer protein
Component typeTrbD
UniProt IDC4KSG4
KEGG IDbpr:GBP346_A0972
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 6.8e-11, Aligned region: 1..82
Protein Sequence: 89 a.a.     [Download]
>gi|237811245|ref|YP_002895696.1| conjugal transfer protein [Burkholderia pseudomallei MSHR346]
MSTAGDLPGFEVPLHRALTEPILLGGAPRTVAITNGTLAAAVGLGLQMWVPGLVLWVAGHSLAVWGARVD
PQFLPVFARHLKHKPLLDV
 
Nucleotide Sequence: 270 bp     [Download]
>gi|237810278|ref|NC_012695.1|:937629-937898 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGAGCACGGCCGGCGACCTCCCGGGCTTCGAGGTGCCACTGCACCGCGCACTCACCGAGCCGATCCTGC
TGGGTGGCGCGCCGCGCACCGTGGCGATCACCAACGGCACGCTGGCCGCCGCCGTTGGCCTGGGCCTACA
GATGTGGGTTCCCGGATTGGTGCTTTGGGTCGCCGGCCACTCGCTGGCGGTCTGGGGCGCGCGCGTCGAC
CCGCAGTTCCTGCCGGTGTTTGCTCGGCACCTCAAGCACAAACCACTGCTGGACGTGTGA
 Primer design