SecReT4
Protein ID: 237811246
T4SS name [ID]Trb [479]
Gene symbol-
Locus tagGBP346_A0973
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]937909..940371 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDC4KSG5
KEGG IDbpr:GBP346_A0973
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-35, Aligned region: 456..725
CagE_TrbE_VirB [PF03135], Evalue: 3e-16, Aligned region: 196..402
Protein Sequence: 820 a.a.     [Download]
>gi|237811246|ref|YP_002895697.1| conjugal transfer ATPase TrbE [Burkholderia pseudomallei MSHR346]
MLNLAEYRQRPALLADWLPWAGLIASGVVLNKDGAFQRTACFRGPDLDSATQSELIATTARLNNALRRLG
TGWALFIEAERQPAAEYPHSQFPEPLSWLVDEERRATFEGETADETLRGSVSRSNGHHFESGYHLTLTYL
PPEESRARAAKLLYENVSTPGVDWRERLTAFLAETGRIFDLLDGVMPELAWLDDGETLTYLHATVSARRY
RITVPEVPFYLDALLADAPLIGGLAPMLGDQHLRVVTVRGFPSSTWPGMLDDLNRLGFAYRWSTRFLCMD
KAEAEKELARLRRQWFAKRKNVLALLRETIFQQESPLVDTDASNKAADADAALQELGSDQVAFGYLTATV
TVLDADANVADEKLRRVERVIQGRGFVTIPETLNAVEAWLSSVPGNAYANVRQPIVSTLNLAHLMPVSAV
WAGPQNNAHLDGPPLIVTRTEGATPFRLVTHIGDVGHTLVVGPTGMGKSVLLATLAMQFRRYPGSRILAF
DMGRSMRATILGLDGEHYDLGADCAIAFQPLARIDQEGDRTWAAEWIEGRLRHEGVTVGPDERVAIWSAL
GSLAGAPVEQRTLTGMSVLLQSNALRQALAPYVLGGAHGKLLDADHDRLGSADVQCFEMEELMHSRAAVL
AVLGYLFARFEARFDGAPTLLILDESWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADVQNSSIAP
AIIESCASRIFLPNPQASEPQIRTIYEGFGLNARQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPVTLAF
AAASTPQDQRLIDEVSARTSPSGFASAWLRQRGLDWAADLLHPSSQGETP
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|237810278|ref|NC_012695.1|:937909-940371 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
GTGCTGAACCTTGCCGAATATCGCCAACGCCCAGCCCTGCTGGCCGACTGGCTGCCGTGGGCAGGCTTGA
TCGCATCCGGCGTGGTGCTCAATAAGGACGGCGCGTTCCAGCGCACGGCGTGCTTTCGTGGGCCGGACCT
GGATAGCGCGACGCAGAGTGAGCTGATCGCCACGACCGCGCGGCTGAACAACGCACTGCGGCGACTTGGC
ACGGGCTGGGCGCTGTTCATCGAGGCCGAGCGCCAACCTGCGGCGGAGTACCCGCACTCGCAGTTTCCCG
AGCCGCTGTCCTGGCTGGTCGATGAGGAGCGGCGTGCCACCTTCGAGGGTGAGACCGCAGACGAAACGCT
CAGGGGGAGCGTTTCGCGGTCGAACGGCCATCACTTCGAGAGCGGCTATCACCTGACGCTGACTTACCTG
CCGCCGGAGGAGTCCCGCGCACGTGCTGCAAAGCTGCTCTATGAGAACGTGTCCACGCCCGGTGTGGATT
GGCGCGAGCGGTTGACGGCCTTCCTTGCCGAAACCGGCCGGATTTTCGACCTGCTCGATGGTGTGATGCC
GGAGCTCGCGTGGCTCGATGATGGCGAGACGCTGACCTACCTGCACGCAACCGTCTCGGCGCGACGGTAT
CGCATCACTGTACCTGAGGTGCCGTTCTACCTCGACGCGCTGCTGGCCGATGCGCCTCTGATCGGCGGTC
TCGCACCGATGCTGGGCGATCAGCATCTGCGCGTTGTGACCGTACGCGGCTTTCCGTCCTCGACGTGGCC
AGGGATGCTGGACGACCTGAATCGGCTCGGTTTTGCGTATCGCTGGAGTACGCGCTTTCTGTGCATGGAC
AAGGCGGAGGCCGAGAAAGAACTGGCTCGCTTGCGCCGGCAGTGGTTCGCCAAGCGCAAGAACGTCCTGG
CGCTGCTGCGCGAAACGATCTTCCAGCAGGAGAGCCCGCTGGTCGATACCGATGCCAGTAACAAGGCAGC
CGACGCGGATGCCGCCTTGCAGGAGCTGGGCAGCGATCAGGTCGCGTTCGGCTATCTCACCGCGACCGTG
ACGGTGCTTGATGCCGATGCCAACGTGGCGGACGAGAAGCTGCGCAGGGTGGAGCGTGTCATCCAGGGAC
GCGGCTTCGTCACGATTCCGGAAACGCTGAACGCCGTGGAGGCATGGCTGTCATCGGTGCCAGGCAACGC
CTACGCCAACGTGCGCCAGCCCATCGTCTCGACGTTGAATCTGGCCCACCTGATGCCGGTGTCGGCGGTG
TGGGCCGGGCCGCAGAACAATGCCCATCTTGACGGCCCGCCGCTGATCGTCACGCGCACCGAAGGCGCCA
CGCCGTTCCGGCTGGTGACGCATATCGGCGATGTGGGGCACACGCTGGTGGTTGGGCCGACCGGCATGGG
CAAGTCAGTCTTGCTGGCGACACTGGCGATGCAGTTTCGCCGTTATCCCGGCTCGCGCATTCTGGCGTTC
GACATGGGCCGCTCCATGCGCGCAACAATACTGGGCCTCGATGGCGAGCATTACGACCTGGGCGCGGATT
GTGCGATCGCGTTTCAGCCGCTTGCGCGCATCGACCAGGAGGGCGATCGCACCTGGGCCGCCGAATGGAT
CGAAGGCCGTTTGCGGCATGAGGGCGTCACGGTCGGCCCGGACGAGCGGGTGGCTATCTGGTCCGCGCTC
GGCAGTCTCGCCGGCGCGCCGGTTGAGCAGCGCACGCTCACCGGCATGTCGGTGTTGCTGCAATCCAATG
CGCTGCGGCAGGCACTCGCACCCTATGTGCTGGGTGGCGCGCACGGCAAACTGCTGGATGCCGACCACGA
CCGGCTCGGTTCGGCCGACGTGCAGTGCTTCGAGATGGAAGAACTGATGCACAGCAGGGCCGCCGTGCTG
GCGGTGCTGGGCTATCTGTTTGCGCGCTTCGAGGCGCGCTTCGATGGCGCACCGACACTGCTGATTCTCG
ACGAATCCTGGCTCTTCCTCGATGACCCGGTGTTCGCCGCGCGCATCCGCCAGTGGCTCAAGACACTGCG
CAAGAAGAACGTCAGCGTCATTTTTGCCACGCAGTCATTGGCCGACGTTCAAAATTCGAGCATCGCGCCG
GCGATCATCGAGAGCTGCGCGAGTCGCATCTTCCTGCCGAACCCGCAGGCGAGTGAGCCGCAGATTCGCA
CGATTTACGAGGGTTTTGGGCTGAATGCCCGGCAGATCGAGATCGTCGCCACCGCACAGCCCAAGCGCGA
TTACTACTACCAGTCGCGTCTTGGCAACCGCCTGTTTGATCTGGACCTCGGGCCGGTGACGCTGGCCTTC
GCGGCGGCTTCCACACCGCAGGATCAACGCCTCATCGACGAGGTGTCCGCCCGCACTTCGCCATCTGGCT
TTGCATCAGCATGGCTACGTCAGCGCGGCCTGGACTGGGCCGCCGATCTGCTCCACCCGTCATCGCAGGG
AGAAACGCCATGA
 Primer design