SecReT4
Protein ID: 237811247
T4SS name [ID]Trb [479]
Gene symboltrbJ
Locus tagGBP346_A0974
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]940368..941132 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDC4KSG6
KEGG IDbpr:GBP346_A0974
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|237811247|ref|YP_002895698.1| conjugal transfer protein TrbJ [Burkholderia pseudomallei MSHR346]
MTFHILLKARLTALVAGASLVLTSAQPAHALLGVGDIVFDPTNLVQNTLTAARTLEQINNQIKQLQNEAQ
SLTNQARNLAGLPFNVVNRLRTNLDTTRQLIARAQGVAYDLQQMDQQFVQLYPEQYAATVSGNQMFKDAH
QRWRNTLQGLQTAMRMQAQVSQNVNRDEDVLADLVGQSQSATGALQAMQATNQLLALQAKQSIQTQQLQL
TQDRAASLELARQASAVERGREVTRRFLGNGTAYTPQPVNFYRN
 
Nucleotide Sequence: 765 bp     [Download]
>gi|237810278|ref|NC_012695.1|:940368-941132 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGACGTTCCACATTCTTTTAAAGGCTCGCCTGACTGCGCTGGTCGCCGGCGCGTCGCTGGTTTTGACTT
CCGCGCAGCCCGCCCATGCGCTTTTGGGTGTTGGCGACATCGTGTTCGATCCGACCAACCTCGTGCAGAA
CACTCTGACGGCCGCCCGGACGCTGGAACAGATCAATAACCAGATCAAGCAACTCCAGAACGAGGCGCAG
TCGTTGACGAACCAGGCCCGCAACCTTGCAGGCCTGCCGTTCAACGTGGTCAACCGGCTGCGCACCAACC
TGGACACGACGCGGCAATTGATCGCGCGCGCGCAGGGGGTGGCTTACGACCTCCAGCAGATGGACCAACA
GTTCGTGCAACTGTACCCCGAGCAGTACGCCGCAACCGTGAGCGGCAACCAGATGTTCAAGGACGCGCAT
CAGCGCTGGCGGAACACACTCCAAGGCCTGCAGACTGCGATGCGCATGCAGGCACAGGTGTCGCAGAACG
TGAACCGGGATGAGGACGTGTTGGCCGATCTGGTCGGCCAGAGCCAGTCGGCCACCGGCGCCCTGCAGGC
CATGCAGGCAACCAACCAGCTTCTGGCGCTGCAAGCCAAGCAGTCCATCCAAACGCAGCAGCTTCAGCTC
ACGCAGGATCGGGCGGCTTCCCTGGAACTCGCAAGGCAAGCATCTGCCGTTGAACGCGGACGCGAAGTCA
CGCGCCGTTTCCTTGGCAATGGCACCGCGTACACGCCGCAGCCCGTGAACTTCTATCGCAACTGA
 Primer design