SecReT4
Protein ID: 237811248
T4SS name [ID]Trb [479]
Gene symboltrbL
Locus tagGBP346_A0975
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]941181..942329 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDC4KSG7
KEGG IDbpr:GBP346_A0975
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.4e-49, Aligned region: 38..264
Protein Sequence: 382 a.a.     [Download]
>gi|237811248|ref|YP_002895699.1| P-type conjugative transfer protein TrbL [Burkholderia pseudomallei MSHR346]
MNDVAVIDRFLNIFSTYIDSGFGLLRGEVAFLTATLVGIDMTLAGLYWALGHAAGQGDDVMAKLIRKVLY
VGAFAYIIGNFNMLSGIVFRSFAGLGLTASGSTLSMEIFLQPGRLAKTGIDAGAPILAQISEMAGFPEVF
ANITPIVVLFLAWLVIIVCFFVLAVQLFVTLIEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVSSGIK
VLVLAVIVGIGTGLFSEFQVTPGEPSIDHALVMMLASLAMLALGIFGPGIATGLVSGAPQLGAGAMAGAA
LGATGTAVAVGAAAAGAGSAVATAARIAPAAVRMVAGGARAAEAGAIATNATRATGQQQPAWAKRLHRRQ
QISRAATTAAHTLRGADAGGSGSGPNLRDSDA
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|237810278|ref|NC_012695.1|:941181-942329 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGAACGACGTTGCCGTCATCGATCGCTTTCTCAATATCTTTTCCACGTACATCGATTCAGGCTTTGGCC
TGCTGCGTGGCGAAGTCGCCTTTCTCACGGCAACACTGGTTGGCATCGACATGACGCTGGCTGGCCTGTA
CTGGGCATTGGGACACGCCGCTGGTCAGGGCGACGACGTGATGGCGAAGCTCATCCGCAAGGTGCTGTAC
GTCGGCGCCTTCGCTTACATCATCGGCAACTTCAACATGCTCTCAGGCATCGTGTTTCGCTCGTTCGCCG
GCCTCGGCCTGACGGCGTCCGGCTCGACCTTGAGCATGGAGATATTTCTGCAGCCCGGGCGCCTCGCCAA
GACCGGCATCGACGCGGGTGCACCCATCCTGGCGCAGATCAGCGAGATGGCGGGTTTCCCAGAAGTGTTC
GCCAATATCACGCCCATCGTCGTGCTGTTTCTCGCGTGGCTGGTGATCATCGTCTGCTTCTTCGTGCTGG
CGGTGCAGTTGTTTGTCACGCTGATCGAGTTCAAGCTGACCACGCTCGCGGGTTTCGTGCTGGTGCCGTT
CGCGCTCTGGAACAAGACCGCGTTTCTCGCCGAAAAAGTGCTCGGCAATGTGGTGTCCTCGGGCATCAAG
GTGCTGGTTTTGGCGGTGATTGTCGGCATCGGCACGGGCCTGTTCTCGGAATTCCAGGTGACACCGGGCG
AGCCGTCCATCGACCATGCGCTGGTGATGATGCTGGCTTCGCTCGCCATGCTCGCGCTCGGCATCTTTGG
GCCAGGCATTGCCACGGGGCTGGTGTCCGGCGCGCCGCAACTCGGCGCAGGCGCGATGGCCGGCGCAGCG
CTGGGTGCCACTGGTACGGCTGTGGCGGTTGGTGCTGCGGCCGCCGGTGCGGGCAGCGCAGTGGCAACTG
CTGCGCGCATAGCGCCCGCCGCCGTCAGGATGGTCGCCGGTGGCGCGCGCGCCGCCGAGGCAGGCGCCAT
CGCTACCAACGCAACCCGTGCCACCGGCCAACAGCAGCCCGCCTGGGCCAAGCGCTTGCATCGGCGACAG
CAGATCAGCCGCGCCGCGACTACTGCTGCTCACACGCTGCGCGGCGCAGACGCCGGTGGTTCGGGCAGTG
GCCCGAATCTACGCGATTCCGATGCTTGA
 Primer design