SecReT4
Protein ID: 237811249
T4SS name [ID]Trb [479]
Gene symbol-
Locus tagGBP346_A0976
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]942342..943046 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDC4KSG8
KEGG IDbpr:GBP346_A0976
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.9e-58, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|237811249|ref|YP_002895700.1| conjugal transfer protein TrbF [Burkholderia pseudomallei MSHR346]
MRFKRPQVRYADTPQPATPYQSAAQVWDARIGSARVQAKNWRLMAFGCLVLALMMAGGLVWRSAQSIVTP
YVVEVDQSGQVRTVGEAAIPYRPSDAQIAFHLAHFITLVRSLSIDPVVVRQSWLDAYDYTTDRGAGVLND
YARAHDPFILVGKESVTVQITSVVRASESSFNVRWTEQRFVNGAPASTERWNAMLTTVLQTPRTEQRLRK
NPLGIYINGLSWSRELDTPEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|237810278|ref|NC_012695.1|:942342-943046 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGCGATTCAAGCGACCACAGGTACGCTACGCCGATACGCCGCAGCCTGCCACGCCGTACCAATCCGCCG
CTCAGGTTTGGGACGCACGCATCGGCTCGGCGCGCGTTCAGGCGAAGAACTGGCGGCTGATGGCCTTCGG
CTGCCTGGTGCTCGCGCTCATGATGGCCGGTGGACTGGTCTGGCGCTCAGCGCAGTCGATCGTCACGCCT
TACGTGGTGGAGGTGGATCAGAGCGGTCAGGTGCGTACGGTCGGCGAGGCAGCCATACCGTACCGGCCCA
GTGACGCGCAAATCGCCTTCCACTTGGCGCACTTCATCACGCTGGTCCGTTCGCTCTCCATCGACCCCGT
CGTCGTCCGGCAGAGTTGGCTCGATGCCTACGACTACACCACCGATCGTGGCGCAGGCGTGCTCAACGAC
TACGCTCGCGCCCACGATCCTTTTATCCTCGTCGGCAAGGAGTCGGTGACCGTGCAGATCACCAGCGTCG
TGCGGGCCAGCGAATCGTCGTTCAACGTGCGCTGGACCGAACAGCGTTTCGTCAACGGTGCACCCGCGAG
CACCGAACGCTGGAACGCCATGCTGACCACCGTTCTGCAAACGCCGCGCACCGAGCAGCGGCTGCGCAAG
AACCCGCTGGGGATCTATATCAACGGCCTGTCGTGGAGCCGCGAGCTGGATACGCCTGAAGGAGCGAAGC
CATGA
 Primer design