SecReT4
Protein ID: 237811250
T4SS name [ID]Trb [479]
Gene symboltrbG
Locus tagGBP346_A0977
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]943043..944047 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDC4KSG9
KEGG IDbpr:GBP346_A0977
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.2e-67, Aligned region: 107..326
Protein Sequence: 334 a.a.     [Download]
>gi|237811250|ref|YP_002895701.1| P-type conjugative transfer protein TrbG [Burkholderia pseudomallei MSHR346]
MNALVHQSALPVILLGSTVLFAGCATQGKPPPTIALDEPVQAQPLPEPPKPIEVVTVPQVLPMPAQMKPL
SEGAEVKTAPEPTDEKLRVSRANAEARVAPTREAYVNAIQVWPFTDGALYQVYAAPGRVTVIALQPGEEL
VTVAAGDTVRWIVGDTSSGTGDALRVNVMVKPIRSNLKTNLVITTSRRTYLIELTSTEKAWMASVSWDYP
KDRMLALQRQAQSAQATAPVETGLPLEKIRFRYAVSGSNAPWKPLRAFDDGEKVYIQFPAGIAQGELPPL
FVIGAQGEGQLVNYRFRTPYYIVDRLFGAAELRLGGDKGDVVRIERTDGVTRGN
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|237810278|ref|NC_012695.1|:943043-944047 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGAATGCCCTTGTCCATCAATCCGCGTTGCCGGTGATCCTACTAGGTTCGACCGTGCTGTTTGCAGGCT
GCGCCACCCAAGGCAAGCCACCACCGACCATCGCACTCGATGAGCCGGTGCAGGCTCAGCCGCTACCCGA
GCCGCCGAAGCCGATCGAAGTCGTGACCGTGCCTCAGGTCCTGCCCATGCCTGCGCAGATGAAGCCGCTG
TCGGAGGGCGCGGAAGTCAAGACCGCACCGGAGCCGACTGACGAGAAACTGCGGGTATCGCGGGCTAATG
CCGAGGCGCGTGTTGCACCCACTCGGGAGGCTTATGTCAACGCGATCCAGGTCTGGCCCTTCACCGATGG
TGCGCTCTACCAGGTCTATGCGGCACCGGGGAGGGTGACCGTGATTGCGCTGCAACCTGGCGAGGAACTT
GTGACCGTTGCCGCCGGTGACACAGTGCGTTGGATCGTCGGCGACACATCCAGCGGCACGGGGGACGCGC
TGCGCGTCAACGTGATGGTCAAGCCGATCCGCTCAAACCTGAAGACCAATCTGGTCATCACGACCAGCCG
GCGCACCTACCTGATCGAGTTGACCTCGACCGAGAAGGCGTGGATGGCCTCGGTGTCGTGGGATTACCCG
AAGGATCGTATGCTGGCCTTGCAGCGTCAGGCGCAGTCTGCACAAGCGACGGCGCCGGTCGAAACCGGCC
TGCCGCTGGAGAAGATTCGCTTTCGCTACGCGGTCAGCGGCAGCAATGCGCCGTGGAAGCCGCTGCGCGC
CTTTGACGACGGCGAGAAGGTCTATATCCAGTTCCCGGCGGGCATTGCTCAGGGGGAGTTGCCACCCCTA
TTCGTGATTGGCGCGCAGGGCGAGGGGCAACTGGTGAACTACCGATTCCGCACCCCGTATTACATCGTCG
ATCGATTGTTCGGCGCGGCCGAGCTGCGCCTGGGTGGCGATAAGGGCGATGTGGTGCGCATAGAGCGCAC
GGATGGCGTAACGCGGGGGAACTGA
 Primer design