SecReT4
Protein ID: 237811251
T4SS name [ID]Trb [479]
Gene symbol-
Locus tagGBP346_A0978
StrainBurkholderia pseudomallei MSHR346
Repliconchromosome I [GenBank: NC_012695] [Browse all T4SS(s) in this replicon]
Location [Strand]944050..945330 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDC4KSH0
KEGG IDbpr:GBP346_A0978
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.8e-56, Aligned region: 231..412
Protein Sequence: 426 a.a.     [Download]
>gi|237811251|ref|YP_002895702.1| conjugation TrbI family protein [Burkholderia pseudomallei MSHR346]
MGQDDTPDVPGSDTVPKVAPEAVALRAQPRAVTRLNRRTLALLAGSFGIAVLGATLWSLQPSKQRAANDA
TELYNVDRVSRSEGLDRLPADYAKLPANVPELGPPLPGDLGPAIAKSQQPVTSTYAPPGQDPGAAERDAL
RKEAETAAGSSVFFRSSNQRGNAAPGQTTAAAPASGPLGFDPQAAGPASTAAQPADPTAVQNRQDQKEAF
QKAGSTETRNAGNLQVPTSPYQVMAGTVIAGALVTGIKSDLPGDVIAAMTEPVYDTATGRHLLIPQGSRI
LGRYNSQVSYGQSRVQVVWNRIILPDTSSLTLDKLAGTDPAGYSGLEDGVDWHWDRVFAGAALTTLLGVG
AELAAPQNRSGDRIIIAGRDGLQDSVNQVGQEMTRRNLNIQPTLTERPGLPVRILVNRDLVLRPYQPLFF
NKGTSQ
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|237810278|ref|NC_012695.1|:944050-945330 Burkholderia pseudomallei MSHR346 chromosome I, complete sequence
ATGGGCCAGGACGACACCCCGGACGTACCCGGTTCTGACACCGTGCCGAAAGTCGCACCGGAGGCCGTGG
CTTTGCGGGCGCAGCCGCGCGCGGTGACACGGCTGAACCGGCGCACGTTAGCGCTGCTGGCCGGCAGCTT
TGGCATCGCGGTGTTGGGCGCAACATTGTGGTCTCTACAGCCATCGAAGCAGCGTGCCGCGAACGATGCG
ACCGAGCTCTACAATGTTGATCGCGTCTCTCGCTCCGAAGGGCTCGACCGGCTTCCGGCCGACTACGCCA
AGCTGCCGGCGAACGTGCCGGAGCTGGGGCCGCCGCTGCCCGGCGACCTGGGGCCCGCCATCGCCAAATC
GCAGCAACCGGTGACATCTACCTATGCGCCACCGGGTCAAGATCCGGGGGCGGCCGAACGCGATGCGTTG
CGCAAGGAGGCGGAAACTGCAGCGGGTTCGTCGGTGTTCTTCCGTTCGAGCAATCAACGTGGTAACGCCG
CGCCCGGGCAGACCACGGCGGCCGCTCCGGCATCTGGCCCCCTGGGCTTCGATCCACAGGCGGCAGGACC
AGCCTCCACGGCGGCGCAGCCCGCCGACCCGACTGCCGTGCAAAACCGGCAAGACCAGAAAGAGGCGTTC
CAGAAAGCCGGATCTACGGAAACCCGCAATGCCGGTAATCTGCAGGTGCCCACCTCGCCGTATCAAGTCA
TGGCGGGAACGGTGATCGCAGGTGCGCTGGTGACGGGCATTAAGTCGGATTTGCCGGGCGACGTGATTGC
CGCGATGACGGAGCCAGTCTACGACACGGCGACCGGACGCCATCTGCTGATCCCGCAAGGCTCACGCATT
CTTGGACGCTACAACAGCCAGGTCAGCTATGGACAGAGTCGGGTGCAGGTCGTGTGGAATCGCATCATCC
TGCCCGACACGTCCTCGCTGACGCTGGACAAGCTGGCCGGCACCGATCCGGCTGGCTACTCCGGGTTGGA
GGATGGTGTCGATTGGCATTGGGACCGCGTCTTTGCCGGCGCCGCATTGACGACGCTGCTGGGTGTCGGC
GCCGAGTTGGCTGCACCGCAGAACCGTAGCGGAGACCGGATTATCATCGCAGGGCGCGACGGCTTGCAGG
ACAGCGTGAACCAAGTCGGGCAGGAGATGACTCGGCGCAATCTCAACATTCAGCCCACCTTGACTGAGCG
GCCGGGCCTGCCGGTACGCATCCTTGTCAATCGCGATCTGGTACTGCGGCCCTACCAGCCGCTCTTCTTC
AATAAGGGAACATCGCAATGA
 Primer design