SecReT4
Protein ID: 238023412
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0180
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]18630..22076 [-]
ProductTraG-like protein
Component typeTraG_F
UniProt IDC5ANK1
KEGG IDbgl:bglu_3p0180
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 7e-100, Aligned region: 4..462
Protein Sequence: 1148 a.a.     [Download]
>gi|238023412|ref|YP_002907645.1| TraG-like protein [Burkholderia glumae BGR1]
MNMEIDTYGNVDTLYYVFNGIASFMGSGSFSGFMRFTLLSGLLIAMVAAIGRKSTDIVKWFASAMFITQL
LVAPVENVFITDVTGVQPTREVDHVPAYLSAIAQASTTVSTAVTQAYETVFSVPDSLQLQKGDLGFGISV
LQKVNQAQIVDPGLEADLMQFFKECTVYDIQDGAINPQTIMSGTDPFNTVFTQTSPARYVTTNTLTANPT
TDTCLATGTLLLIRVTDAEQKAEQMYGKEMYPQVTDASAAKAAFVNAIGDSYGFILQSSQNASSALRQAM
FNNVWRQAGADLPAMLNDPARVAEVNALMSSAQAAVAANGSMASVAILAKETLPTVRNYAEAIIYTIFPI
VIVLCLVGGGEAAKRILGGYAKTIAWIGLWPVIFAVLNGLSLMHLSSKMQAMSLQAGVPFGMAAKFGSTL
IDEQVLLGYMVILTPALAWGLLNMATTSVVGAFQGVAGGFQGIAQQIGGQQAQGDENIGNVHMDTSSIGN
STRNVTSANKYDTAGLFRTGSTTIEQGTGSSFTNFDNGLITRADTQSSLGFAMSSQSAIEKTVGADTSTG
ISATKTSTAFAARDQVASGTTSLASSKERGNSQRSGDEATKGVHGSTTQAVDLRRTKDQQYVIDQTHSVE
DQLSTGVRGSLQLGGTFEKSFGDGAPGQPASGVRGGMPAGARQGAPRSVGAGTGNPPANSPIFSQAEEDR
LAQKASSLGKSPQEIQDVRDAYRNKVRGVDYATGGGTGGGRAAGKLGGELAIDGGRTRAWRDSEAQRFVD
QYGSFAGYTEGSQVSHDASKNHSEYKGAESGQHARTEHAASLTEQASSGARDAADLTRTADVRQRGSTQQ
VSRVDTTNNLLTPENLQAVAARNGMRYGRLMTLPAAEIQRLVSEDALMRDLVKRNSALPPTARDGSSLPS
GQGDVVRQNKHDRSGIGANIPGAFQRFSSDVGPVDTTPLDVKPSVPSEVSGAQARVDAVRQRVSDDADLP
IRQVQDHVIPSDDNRSLMTLDRSPARPLVTRPTGESPGTSSPERLSEADFKIVPIDGPSSEMTPARSAGA
AVVQPKLSAGDFQIISADDHGGGSVTAATGVATDDLNLSRPDFTRMPADGLTANASAAKPTSISASSDSL
PARSESGSSIGRTDPAGSSLGDKEGGKQ
 
Nucleotide Sequence: 3447 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c22076-18630 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGAACATGGAAATCGACACCTACGGGAACGTCGACACGCTCTATTACGTGTTCAACGGCATCGCGTCGT
TCATGGGTAGCGGCTCGTTCAGCGGCTTCATGCGGTTCACGCTGCTGAGCGGACTGTTGATCGCGATGGT
CGCCGCCATCGGGCGCAAGAGCACGGACATCGTGAAGTGGTTCGCGAGCGCGATGTTCATAACGCAGCTG
CTCGTCGCGCCGGTCGAGAACGTGTTCATTACGGATGTGACCGGCGTCCAGCCGACCCGCGAGGTGGACC
ACGTCCCCGCCTACCTGAGCGCGATCGCTCAGGCGAGCACGACGGTGTCGACGGCGGTCACCCAGGCCTA
TGAGACGGTGTTCAGCGTACCCGATTCGCTTCAGCTGCAGAAGGGCGACCTCGGATTCGGGATATCCGTG
CTTCAGAAGGTGAATCAGGCGCAGATCGTCGATCCCGGCCTCGAGGCGGACCTGATGCAGTTCTTCAAGG
AATGCACGGTCTACGACATCCAGGACGGGGCGATCAACCCGCAAACGATTATGAGCGGGACCGATCCGTT
CAATACCGTCTTCACGCAAACGAGCCCGGCCCGGTACGTGACGACCAACACGCTGACCGCGAATCCAACG
ACGGACACCTGTCTGGCCACCGGAACGCTGCTGTTGATCCGCGTCACGGACGCCGAGCAGAAGGCGGAAC
AGATGTACGGCAAGGAGATGTACCCCCAGGTGACCGACGCGTCGGCCGCCAAGGCGGCGTTCGTCAATGC
GATCGGCGACTCGTACGGCTTCATCCTGCAGTCGTCGCAGAACGCCTCGTCAGCGCTGCGCCAGGCCATG
TTCAACAACGTCTGGCGCCAGGCTGGTGCCGATCTGCCGGCGATGCTCAATGACCCAGCCCGCGTTGCCG
AGGTGAATGCGCTGATGAGTTCGGCGCAGGCTGCCGTGGCCGCGAACGGCTCGATGGCAAGCGTGGCCAT
CCTGGCGAAGGAGACGCTGCCGACCGTCCGCAATTATGCAGAGGCGATTATCTACACGATCTTCCCGATC
GTGATCGTGCTGTGTCTCGTCGGAGGGGGGGAGGCGGCCAAGCGCATCCTGGGCGGTTACGCCAAGACCA
TCGCGTGGATCGGGCTGTGGCCGGTGATCTTCGCGGTACTCAACGGCCTCTCGCTCATGCATCTGAGCAG
CAAGATGCAGGCGATGTCGCTGCAGGCAGGTGTGCCGTTCGGCATGGCGGCCAAGTTTGGCAGCACGCTC
ATCGATGAACAGGTGCTGTTGGGGTACATGGTGATCCTGACGCCGGCCCTCGCGTGGGGGCTGCTCAACA
TGGCCACCACCAGCGTGGTTGGCGCGTTCCAGGGAGTCGCTGGAGGCTTCCAAGGCATCGCGCAACAGAT
TGGTGGCCAGCAAGCGCAGGGCGACGAGAACATCGGCAACGTCCACATGGATACGTCGTCGATCGGTAAC
TCGACGCGCAATGTCACGTCGGCGAACAAATACGACACCGCGGGCCTGTTCAGAACGGGGTCAACGACCA
TTGAGCAGGGAACGGGCTCGTCGTTCACGAACTTCGACAACGGGCTCATCACGCGCGCTGACACCCAGAG
CAGCTTGGGATTTGCGATGTCGTCGCAGAGCGCGATTGAAAAGACCGTGGGCGCCGATACCTCGACTGGC
ATCTCGGCCACCAAAACCAGCACTGCATTCGCCGCCCGGGATCAGGTGGCGTCCGGTACGACTTCCCTCG
CAAGCAGCAAGGAGCGCGGTAACTCGCAGCGCTCGGGCGATGAGGCGACCAAAGGAGTGCATGGTTCGAC
GACGCAAGCCGTGGACCTCCGGCGGACGAAGGACCAGCAGTATGTGATTGATCAAACACACTCTGTCGAA
GACCAACTATCAACCGGTGTGCGCGGGTCACTTCAGCTGGGGGGAACTTTCGAAAAGTCCTTCGGCGACG
GCGCGCCCGGCCAGCCCGCTAGCGGCGTGCGAGGCGGAATGCCGGCCGGCGCTCGCCAAGGCGCACCGCG
CAGTGTCGGGGCTGGCACCGGTAACCCGCCTGCTAACTCGCCGATCTTCAGTCAAGCAGAGGAAGATCGG
CTGGCGCAGAAAGCTTCAAGTCTCGGTAAGTCTCCGCAAGAAATTCAAGATGTTCGGGATGCCTATAGAA
ATAAAGTTCGGGGCGTTGATTATGCAACTGGTGGAGGGACTGGGGGCGGCCGCGCCGCTGGGAAACTTGG
AGGAGAACTCGCGATTGATGGGGGACGAACAAGGGCGTGGCGAGATAGCGAAGCACAGAGGTTTGTTGAC
CAGTACGGAAGTTTTGCGGGCTACACGGAGGGCAGCCAGGTTTCCCACGACGCCTCGAAGAACCACTCCG
AATACAAGGGGGCTGAGTCAGGTCAGCATGCTCGCACGGAGCATGCAGCTTCCCTCACCGAGCAAGCCTC
GTCCGGCGCGCGCGATGCAGCGGACCTGACTCGCACGGCAGACGTTCGGCAGCGGGGATCGACGCAACAA
GTATCGCGTGTTGACACGACCAACAATCTGCTGACCCCTGAGAACCTGCAAGCGGTTGCCGCTCGCAACG
GTATGCGATATGGCCGGCTGATGACGTTGCCCGCCGCGGAGATTCAGCGCCTTGTCAGTGAGGATGCGCT
GATGCGGGACCTCGTTAAGCGCAATTCCGCGTTGCCGCCGACAGCGCGTGACGGCTCGTCGTTGCCGTCT
GGGCAGGGCGATGTCGTCCGCCAAAACAAGCACGATCGGTCGGGTATCGGCGCCAATATTCCAGGGGCTT
TCCAGCGCTTTTCGAGCGACGTGGGGCCGGTAGACACGACGCCTCTGGATGTGAAGCCTTCCGTCCCCAG
TGAGGTGAGCGGCGCCCAAGCTCGAGTCGATGCCGTGAGGCAACGCGTATCGGACGATGCGGATTTGCCC
ATCAGGCAGGTACAGGACCACGTTATTCCGTCGGACGACAACAGGTCCCTGATGACGCTAGATAGGTCGC
CGGCGCGCCCGCTCGTAACCAGGCCCACGGGTGAATCGCCGGGGACGAGTTCGCCAGAACGCCTGTCCGA
GGCTGATTTCAAGATCGTCCCGATCGACGGCCCGTCTAGCGAAATGACACCCGCCCGTTCAGCAGGAGCG
GCCGTGGTCCAGCCGAAGCTCTCTGCGGGGGATTTCCAGATCATCTCGGCGGACGACCATGGAGGCGGGT
CTGTGACGGCAGCCACCGGCGTAGCAACAGATGATCTGAATCTGTCCCGGCCGGATTTCACGCGCATGCC
CGCTGATGGCCTGACAGCCAACGCAAGCGCCGCTAAGCCCACTTCTATCTCGGCGTCTAGCGACTCACTG
CCGGCTCGGTCGGAGTCGGGTAGCTCGATCGGGCGAACTGACCCCGCTGGATCGTCGCTTGGAGACAAGG
AGGGTGGAAAGCAATGA
 Primer design