SecReT4
Protein ID: 238023413
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0190
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]22073..23518 [-]
ProductTraH-like protein
Component typeTraH_F
UniProt IDC5ANK2
KEGG IDbgl:bglu_3p0190
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 7e-107, Aligned region: 27..389
Protein Sequence: 481 a.a.     [Download]
>gi|238023413|ref|YP_002907646.1| TraH-like protein [Burkholderia glumae BGR1]
MKPSRWVAALVAGVIAASPIASDAMSMQQVFDSINSMGNVSSPRVLQGETMNMYSGGSVFMRTPHKTYQL
ASVTAPSWGAGCGGIDLFTGGFSFINKEQFVALLRNIGSNALGYAFKLALQNLCPTCDNVMQSLQAIAKD
INRMNIDSCQAAEGVVNAVTPGTWKKEQANLADTAGPFMNLYSDMTDAWSNTSNNATQAAATINTATAQN
PNLAAKQPYGNVTWQALLQLPDLSTSDREFLMSLVGTVIFPDPSDSNGTEVNPIFLPRIGSVTVEELVGN
DPASSTTDTIQLYQCDETTKCLNPSTQEVQFTTFRSLVQAKLQRIVDAVATRSPLADPTDTFQFLSMTDL
PVYKMIAVSTRLNNSSVADQMLATYQSLMAAKYAEAYIRGSAEDLRRAIARYSTVSTSTSLLNQTTRINE
SIDSVEREARDVVMEAFRQTSNAWALVEELQSMERAIHSSISPSLRNSLAFGQTLTSGSTQ
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c23518-22073 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGAAACCGTCCCGTTGGGTCGCCGCGCTCGTCGCCGGCGTGATCGCCGCCAGTCCCATCGCATCCGATG
CGATGTCGATGCAGCAGGTATTCGACTCCATCAACTCGATGGGCAACGTATCCAGCCCGCGCGTGCTGCA
GGGCGAGACGATGAACATGTACAGCGGCGGCAGCGTCTTCATGCGCACGCCGCACAAGACCTATCAGCTC
GCGAGCGTGACCGCGCCCTCCTGGGGCGCGGGCTGTGGCGGGATCGACCTGTTCACCGGCGGCTTCAGCT
TCATCAACAAGGAGCAGTTCGTCGCCCTGCTACGCAACATCGGCTCGAACGCGCTCGGCTACGCCTTCAA
GCTCGCGCTGCAGAACCTCTGCCCCACCTGCGACAACGTCATGCAGTCGCTGCAGGCGATCGCCAAGGAC
ATCAACCGGATGAACATCGACTCGTGCCAGGCGGCCGAGGGCGTCGTGAACGCCGTGACGCCGGGCACGT
GGAAGAAGGAGCAGGCGAACCTCGCGGACACCGCCGGACCGTTCATGAACCTCTATTCGGACATGACGGA
CGCGTGGTCGAACACCAGCAACAACGCCACCCAGGCTGCGGCGACGATCAACACGGCGACCGCGCAGAAC
CCGAATCTCGCGGCCAAGCAGCCGTATGGGAACGTCACGTGGCAGGCGCTGCTGCAGCTGCCCGACCTCA
GCACGTCGGATCGCGAATTCCTGATGTCGCTCGTCGGCACGGTGATCTTCCCGGACCCCTCCGATTCGAA
CGGCACCGAAGTCAACCCGATTTTCTTGCCCCGCATCGGTAGCGTGACCGTCGAGGAACTCGTTGGTAAC
GATCCGGCCAGCTCGACCACGGACACCATCCAGCTCTACCAGTGCGACGAGACGACGAAGTGCCTGAATC
CGTCCACCCAGGAGGTGCAGTTCACCACCTTCCGATCGCTCGTCCAGGCGAAGCTGCAACGCATCGTCGA
CGCGGTGGCAACCCGGTCGCCGCTGGCTGATCCCACCGACACATTCCAGTTCCTGAGCATGACCGACCTG
CCTGTCTACAAGATGATCGCGGTCAGCACGCGACTGAACAATAGCTCTGTCGCCGACCAGATGCTGGCCA
CCTACCAGTCTCTGATGGCCGCCAAGTACGCGGAAGCCTATATCCGCGGCTCGGCCGAGGATCTGCGCCG
CGCGATCGCGCGCTACAGCACCGTCAGCACGAGCACATCGCTGTTGAACCAGACCACGCGTATCAACGAG
AGCATCGACTCGGTGGAGCGCGAAGCGCGCGACGTGGTCATGGAGGCCTTCCGCCAGACGTCGAACGCAT
GGGCGCTCGTTGAGGAACTTCAGTCCATGGAGCGTGCGATTCACAGCAGCATCTCGCCGTCGCTGCGCAA
TTCGCTCGCGTTCGGCCAGACCCTGACATCGGGGTCGACGCAATGA
 Primer design