SecReT4
Protein ID: 238023414
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0200
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]23518..24336 [-]
ProductTraF-like protein
Component typeTraF_F
UniProt IDC5ANK3
KEGG IDbgl:bglu_3p0200
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.4e-71, Aligned region: 46..261
Protein Sequence: 272 a.a.     [Download]
>gi|238023414|ref|YP_002907647.1| TraF-like protein [Burkholderia glumae BGR1]
MRALIRPLVSALMAVCTAYTALAAPRAQANDLDYPSAWQCDGQAKFNWYCDDDDKPAAPAVASAAAPADP
DDFSRFKTADEMRAALKHRLDIATMDPTEANVKSYKRLELYVMAKSATYADVSRRVVWQNPDLDYSLKRP
TNNVAVHTYDQARDNDQDAQLRALAEKHGLIFFFRHDCPYCHALAPTIRLLADRYGIDVLPVSLDGQGIP
GFPNPTADHGQASIWEVQQVPALFIASKETGDHAMIGSGVLSLQDIVDRIFVLTATKPGELF
 
Nucleotide Sequence: 819 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c24336-23518 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGCGAGCGTTGATACGCCCTCTCGTGTCCGCGCTGATGGCGGTGTGCACCGCCTATACCGCATTGGCCG
CGCCCCGCGCGCAGGCCAATGACCTCGACTACCCGTCCGCGTGGCAGTGCGACGGTCAGGCGAAGTTCAA
CTGGTATTGCGATGACGACGATAAGCCGGCGGCCCCGGCGGTCGCGAGCGCAGCCGCGCCGGCGGACCCC
GACGACTTCTCCCGGTTCAAGACGGCCGATGAGATGCGCGCGGCCCTCAAGCACCGGCTCGACATCGCGA
CGATGGACCCGACCGAAGCGAACGTCAAATCGTATAAGCGGCTCGAGCTGTATGTGATGGCAAAGAGCGC
GACCTACGCGGACGTGTCGCGGCGCGTGGTCTGGCAGAACCCGGATCTCGACTACTCGCTCAAGCGGCCG
ACCAACAACGTTGCCGTCCACACCTACGACCAGGCGCGCGATAACGATCAGGACGCGCAGCTGCGCGCGC
TCGCCGAGAAGCACGGGCTCATCTTCTTCTTCCGGCACGACTGCCCGTACTGCCACGCGCTCGCCCCGAC
CATTCGCTTGCTCGCGGATCGATACGGGATCGACGTGTTGCCGGTGTCTCTCGACGGACAGGGGATTCCG
GGCTTCCCGAACCCAACGGCCGACCACGGCCAGGCCTCGATTTGGGAAGTGCAGCAAGTGCCAGCTCTCT
TTATCGCGTCGAAGGAAACCGGAGACCACGCCATGATCGGCTCGGGTGTCTTGTCGCTCCAGGACATCGT
CGATCGCATCTTCGTTCTCACCGCCACGAAGCCAGGGGAACTCTTCTGA
 Primer design