SecReT4
Protein ID: 238023416
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0220
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]25147..26412 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDC5ANK5
KEGG IDbgl:bglu_3p0220
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.1e-35, Aligned region: 29..212
TraN [PF06986], Evalue: 1.1e-35, Aligned region: 304..368
Protein Sequence: 421 a.a.     [Download]
>gi|238023416|ref|YP_002907649.1| conjugal transfer mating pair stabilization protein TraN [Burkholderia glumae BGR1]
MTITLRCALPATLLVSLLAGPGVASAVPTCQRTGETCVEPAGTRTINGIPVYADCWNYQDTYQCQAANAV
DDCAPLRQEGCGMVGQQCLSYNDASPNTCDTWQYTYQCVDTPAHTTTVTQCTNTMCAPGAGCFTSSSKPD
NALGQVVTGLETGREAGAYGVDAAGNVNIFKGYDSSCTIKVLGGAEIKSCCTSNGGGGAYTNNAIGSAAV
SAGLSIAGTTAKQGIALGSKYVYDQLYQTVDSTLVNQGLQQMGSWADKVLAGSGNFGAYGFQFSFSLTNG
INFVGFNPYVFGAEIAAQLIQMWLACTQDEQVLSLKRGQNLCVQYAQGCSSKVLGVCVEEKKSYCCFNSL
IAKIVNQQGKAQLGVPFAGCSGLTADQLQHVDFSKIDFTEFVNSIQSKAVDQGAILQTIQQQMSSGKGAS
Q
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c26412-25147 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGACGATCACCCTGCGTTGCGCCCTCCCAGCCACCCTGCTCGTGTCCCTCCTGGCCGGCCCAGGCGTGG
CGAGCGCGGTGCCGACCTGCCAGCGCACCGGGGAGACCTGCGTCGAGCCGGCCGGCACGCGCACGATCAA
CGGCATTCCCGTCTACGCCGACTGCTGGAACTACCAGGACACGTACCAGTGCCAAGCGGCCAACGCCGTG
GACGACTGCGCTCCGCTGCGCCAGGAGGGCTGTGGCATGGTCGGGCAGCAATGCCTGTCGTACAACGACG
CGTCGCCGAACACCTGCGACACATGGCAGTACACGTACCAATGTGTCGACACGCCGGCGCACACGACCAC
GGTGACGCAATGCACGAACACCATGTGCGCGCCTGGCGCCGGCTGCTTCACGTCGTCGAGCAAGCCTGAT
AACGCACTTGGCCAGGTGGTGACCGGCCTCGAAACCGGCCGCGAGGCGGGCGCCTATGGGGTAGATGCCG
CCGGCAACGTAAACATCTTCAAGGGCTACGACAGCAGTTGCACGATCAAGGTGCTCGGCGGTGCCGAAAT
CAAGAGCTGCTGCACGAGCAACGGCGGCGGCGGCGCCTACACGAACAACGCCATTGGTAGCGCCGCGGTC
AGCGCCGGGCTGTCGATCGCCGGCACGACCGCGAAACAGGGCATCGCGCTCGGCTCCAAGTATGTGTACG
ACCAGCTCTACCAGACGGTCGACAGCACGCTGGTCAACCAGGGGCTGCAGCAGATGGGATCGTGGGCAGA
CAAGGTGCTCGCCGGCTCCGGCAATTTCGGCGCCTACGGCTTTCAGTTCTCGTTCTCACTGACCAATGGC
ATCAACTTCGTCGGATTCAATCCGTACGTTTTCGGCGCCGAGATTGCTGCGCAGCTGATTCAGATGTGGC
TTGCCTGCACGCAAGACGAACAGGTCCTGAGCCTCAAGCGCGGACAGAACCTATGCGTGCAGTACGCCCA
GGGCTGCTCGAGCAAGGTGCTAGGCGTGTGCGTCGAGGAAAAGAAAAGCTACTGCTGCTTCAACTCGCTC
ATCGCGAAGATCGTCAACCAGCAGGGCAAGGCCCAGCTCGGCGTGCCCTTCGCCGGCTGCAGCGGCCTGA
CGGCGGATCAGCTGCAGCACGTCGATTTCTCGAAGATCGACTTCACCGAGTTCGTCAATTCGATCCAGTC
CAAGGCGGTGGATCAGGGCGCGATTCTCCAGACCATCCAGCAACAGATGTCCTCCGGCAAAGGAGCGTCT
CAATGA
 Primer design