SecReT4
Protein ID: 238023418
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0240
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]27707..28498 [-]
Producttype-F conjugative transfer system pilin assembly protein TrbC
Component typeTrbC_F
UniProt IDC5ANK7
KEGG IDbgl:bglu_3p0240
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.4e-28, Aligned region: 132..241
Protein Sequence: 263 a.a.     [Download]
>gi|238023418|ref|YP_002907651.1| type-F conjugative transfer system pilin assembly protein TrbC [Burkholderia glumae BGR1]
MSPTTRLIVAAAAASFLLPVITQAQTLSSDALAREQQRVNAGRRATFDAAASGAARYHGAMPTDTAIDAE
MARIQGDRQQQMRDAAAKAAHDGNDFPNLPTPARPAASADPLAIAKRYEGRMQRRVTDSFVAFASFSMPD
ASLVRLIKTMHIAGGTVVFRGFKDDSLKATAAEMQRLGVASGGIVVNPKAFTQYRVSRVPAFVVTQGGDA
GNQVDSSGCALPQTFVSVSGDVTPGYALRQIVEHSPAFAANAGRYLRALGDVE
 
Nucleotide Sequence: 792 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c28498-27707 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGAGCCCCACCACTCGCCTCATTGTCGCCGCGGCGGCCGCGAGCTTCCTCCTGCCCGTCATCACCCAGG
CGCAGACGCTCTCCAGCGACGCGCTCGCCCGTGAGCAGCAGCGCGTCAATGCCGGCCGGCGGGCGACGTT
CGATGCCGCGGCGAGCGGCGCCGCGCGCTATCACGGCGCGATGCCAACGGACACCGCCATCGATGCCGAG
ATGGCGCGCATCCAGGGCGATCGGCAGCAACAGATGCGCGACGCGGCGGCGAAGGCGGCCCACGACGGCA
ACGACTTCCCGAACCTCCCAACGCCGGCCCGGCCGGCGGCCAGCGCCGACCCGCTCGCAATCGCCAAACG
CTACGAAGGTCGCATGCAGCGCCGCGTGACCGACTCGTTCGTCGCATTTGCGAGCTTCTCGATGCCTGAC
GCGTCGCTCGTGCGGCTCATCAAGACGATGCACATCGCCGGCGGCACCGTCGTCTTCCGCGGATTCAAGG
ACGACTCGCTCAAGGCGACGGCCGCGGAAATGCAGCGCCTCGGTGTCGCCTCCGGCGGCATCGTCGTCAA
TCCGAAGGCGTTCACCCAGTATCGCGTTTCGCGCGTGCCGGCGTTCGTGGTGACCCAAGGCGGCGATGCG
GGCAACCAGGTCGATAGCAGCGGCTGCGCGTTGCCGCAAACATTCGTGTCCGTCTCGGGCGACGTGACCC
CGGGTTATGCACTGCGGCAGATCGTCGAGCACAGCCCGGCGTTCGCGGCGAACGCGGGCCGCTACCTCCG
CGCGCTGGGCGACGTCGAGTGA
 Primer design