SecReT4
Protein ID: 238023419
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0250
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]28495..29526 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDC5ANK8
KEGG IDbgl:bglu_3p0250
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 8.3e-77, Aligned region: 35..334
Protein Sequence: 343 a.a.     [Download]
>gi|238023419|ref|YP_002907652.1| TraU family protein [Burkholderia glumae BGR1]
MSQSFSLLRRLLALAFVAMSFGFATSADAGQCVGRFANPVTDICWECAFPMAIGDVTLFSMGQDDTSNPG
GFLCFCNGTFGVKFSFWEPVRRVDVTRSPYCFVSLGGISLNPGISAPEGDVRLQQDNTRQSFYQVHWYTD
PVMYYTEILLDDPCMETGSFDVAYLTEVDPTWSDDDLTMLLEPETYLFGSPVAQAACAGDCVLSSLGFGS
NLLFWCAGCNGSIYPFNGHVQAHVSAVQASSLLVERMTAKLHREGLMWGTTGDGAMCGYYLQPVMDKTQY
KYTMLYPVAQTDEINGQCCQPYGRTSALWGAGKMIPYTGEDFAYEVFRKRNCCQGANLGDLPQ
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c29526-28495 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGAGCCAATCTTTTAGCCTCCTTCGACGGCTTCTGGCTCTCGCATTCGTCGCGATGTCGTTTGGCTTCG
CAACTTCTGCCGACGCCGGCCAGTGCGTGGGCCGCTTCGCCAATCCTGTCACCGACATCTGCTGGGAGTG
CGCCTTCCCGATGGCGATCGGCGACGTGACGCTCTTCAGCATGGGCCAGGACGATACGTCCAATCCCGGC
GGCTTCCTCTGCTTCTGCAACGGCACCTTCGGCGTGAAGTTCAGCTTCTGGGAGCCGGTGCGCCGCGTTG
ACGTCACCCGCTCGCCCTATTGCTTCGTCTCGCTCGGCGGTATCTCGCTCAACCCCGGCATCTCGGCGCC
CGAGGGCGACGTGCGCCTGCAGCAAGACAACACGCGCCAGAGCTTCTATCAGGTCCACTGGTACACGGAC
CCGGTGATGTACTACACCGAGATCCTGCTCGACGATCCCTGCATGGAAACAGGCAGCTTCGACGTCGCGT
ATCTCACCGAGGTCGACCCGACCTGGAGCGACGACGATCTGACCATGCTCCTCGAGCCGGAGACGTATCT
CTTCGGCAGCCCCGTCGCTCAGGCGGCCTGCGCCGGCGACTGCGTTCTGTCGTCGCTCGGCTTCGGCAGC
AACCTGCTGTTCTGGTGCGCCGGCTGCAATGGCTCGATCTACCCATTCAACGGCCACGTCCAGGCGCATG
TATCGGCCGTCCAGGCGTCGTCTCTGTTGGTCGAGCGCATGACCGCCAAGCTTCACCGCGAAGGTTTGAT
GTGGGGCACCACTGGCGACGGCGCGATGTGCGGGTACTACCTCCAGCCGGTGATGGACAAGACGCAGTAC
AAGTACACGATGCTCTACCCGGTCGCACAGACCGACGAAATCAATGGCCAATGCTGCCAGCCCTACGGCC
GCACGTCGGCTCTCTGGGGCGCCGGCAAGATGATCCCGTACACCGGCGAGGACTTCGCCTACGAGGTCTT
CCGCAAGCGCAACTGCTGCCAGGGCGCCAACCTCGGAGACCTCCCCCAATGA
 Primer design