SecReT4
Protein ID: 238023420
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0260
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]30507..31145 [-]
Producttype-F conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDC5ANK9
KEGG IDbgl:bglu_3p0260
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 1.6e-11, Aligned region: 6..35
Protein Sequence: 212 a.a.     [Download]
>gi|238023420|ref|YP_002907653.1| type-F conjugative transfer system protein TraW [Burkholderia glumae BGR1]
MARTGRWIAIAAVVLTAAGAHSEDLGVVGPTYPIAEHDAVAMLKHRLAQLQASGGLAALEQRARRRAMHD
ITDMPAVPGVSTVTEYAQRLIDPTVTYSKPVLNDEGAVIVPAGTRINPLDLVTLHERLVFFDGRDPAQVK
AARALADREGAAVKPILTGGSWFDLTKSWKRQVYFDQQGRLTQRFGITRVPAVISQRGNQLLLEEEPAAQ
LR
 
Nucleotide Sequence: 639 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c31145-30507 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGGCACGCACCGGTCGGTGGATTGCCATCGCGGCAGTGGTGCTCACGGCCGCCGGCGCTCACTCGGAAG
ACCTGGGCGTTGTCGGCCCGACCTATCCGATCGCCGAGCACGACGCGGTGGCCATGCTCAAACACCGCCT
CGCGCAGTTGCAGGCCAGCGGCGGACTGGCCGCGCTCGAGCAGCGCGCGCGTCGCCGCGCGATGCACGAC
ATCACCGACATGCCGGCGGTGCCGGGCGTCTCGACGGTGACCGAGTACGCCCAGCGCCTCATCGATCCGA
CCGTTACGTACTCCAAGCCGGTGCTGAACGACGAGGGCGCCGTGATCGTGCCCGCCGGCACTCGCATCAA
TCCGCTCGACCTCGTCACGCTGCACGAGCGCCTGGTGTTCTTCGACGGCCGTGACCCGGCCCAGGTCAAG
GCGGCTCGCGCGTTGGCCGATCGCGAAGGCGCTGCCGTGAAGCCGATCCTCACCGGCGGCTCATGGTTCG
ACCTCACGAAGTCATGGAAGCGGCAGGTGTACTTCGACCAGCAAGGGCGTCTCACGCAGCGATTCGGCAT
CACGCGTGTGCCGGCGGTGATCAGCCAGCGCGGCAACCAACTGCTGCTCGAGGAGGAGCCGGCCGCACAA
CTGCGGTGA
 Primer design