SecReT4
Protein ID: 238023423
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0290
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]32024..34624 [-]
Producttype-IV secretion system protein TraC
Component typeTraC_F
UniProt IDC5ANL2
KEGG IDbgl:bglu_3p0290
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 9.7e-49, Aligned region: 47..291
AAA_10 [PF12846], Evalue: 9.6e-47, Aligned region: 490..780
Protein Sequence: 866 a.a.     [Download]
>gi|238023423|ref|YP_002907656.1| type-IV secretion system protein TraC [Burkholderia glumae BGR1]
MGSIQEWVDSARSLATTMAKELVFGTGDDLGPPAPTVADQRRVDNVGLHQLLPYDQYDPATELYYNTSSI
GFVLVVAPQTGANDELARTLLGLYDTMPADHGVQWMMLADPIIEEHLDRYVDLRRTYANSGEAPPFYLEQ
AERRAAALRANQGRPLFHGQNYSITDKRLMLSVVRKGSADDAKVREEMQNLREVVGATLRSASLASRTAT
PDDLIRFLWPILNPEYLFGNGAEVVDQQYDSDRPIRDQLVPFGHHARVKAEHLLFGLPPEEKGDPDKRIA
ARSFGVLQYPSKKELWEMGNIVGSLFNDVHQYPCPYLITLGVMTLDQNAVETRAALRGARAAQNAKSKMA
PLQPELALQDRDWRAVGLQLESGGSICELYHTLTLFAPRDGIERCVAAARGIWRSERFKLFPMVTQQLTT
LLSAMPMALTPDLRDDLNKLRLISTKTTVNATDMAPVVAEWGGTRGAPSLLFYGRRGTPALIDLYSSPTN
YNGFVDGTTGAGKSVLMNEIIAAFRSVGGIVRVCDVGYSYEKQISLAGGQYIDFKPNSGIVINPFSSAGF
DPENGIDQEVKFIRPIIARMVSPTAPIEQFEGALLDLAVRQVWQDYGRDGSPTLVSKALLSLKDQNKRPE
RVAYELSVRLGPFCDGGVYGRYVNGPTNVRLDNEIIGLELEHLNSDPDLRTVILLGLTNQVTNEMYRFDR
SRKKLFLTDEGWQVVGDDKETAEFMEEGYRRARKYEGSFFFGTQGIGDTKLNRAIQAAFDFSAWKFHMAQ
GKDAIPKIEREKSIDLSPSLKKMLSSLAPYPGRYSEFVLVDPNGDEHLLRHIPEEFTLAMATTKGPDYNF
MQRLIQQGVSTEDAIRSLIEHKRSRA
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c34624-32024 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGGGATCGATCCAGGAGTGGGTGGATAGCGCGCGCAGCCTCGCGACGACGATGGCGAAGGAGCTCGTCT
TCGGGACTGGCGACGATCTCGGGCCGCCGGCACCGACCGTTGCCGACCAGCGCCGCGTCGACAACGTGGG
CCTGCACCAGTTGCTGCCCTACGACCAATACGACCCGGCCACCGAGTTGTACTACAACACCAGCTCGATC
GGCTTCGTACTGGTGGTGGCGCCCCAGACCGGCGCGAACGACGAGTTGGCGAGAACGCTGCTCGGCCTGT
ACGACACCATGCCGGCGGACCACGGTGTGCAGTGGATGATGCTGGCCGATCCGATCATCGAGGAGCACCT
GGATCGGTACGTGGATCTGCGCCGCACGTATGCCAACAGCGGCGAGGCCCCGCCCTTCTACCTCGAGCAG
GCCGAGCGCCGTGCTGCCGCCCTCCGGGCGAACCAGGGACGCCCGCTCTTCCACGGCCAGAACTATTCGA
TCACTGACAAGCGTCTGATGCTGTCAGTCGTACGCAAAGGGTCCGCCGACGACGCCAAGGTTCGCGAGGA
GATGCAGAACCTGCGCGAAGTGGTCGGTGCGACGCTTCGCTCGGCCAGCCTCGCGAGCCGCACCGCTACG
CCCGATGATCTCATCCGCTTCCTGTGGCCGATCCTGAACCCCGAGTACCTCTTTGGTAATGGGGCGGAGG
TGGTCGACCAGCAATATGACTCGGACCGCCCGATTCGCGACCAGCTGGTGCCGTTTGGTCATCACGCGCG
CGTCAAGGCCGAGCATCTGCTTTTTGGCCTGCCGCCGGAGGAAAAGGGCGACCCCGACAAGCGGATTGCG
GCGCGCAGCTTTGGCGTGCTGCAGTATCCGTCGAAGAAGGAACTATGGGAGATGGGCAACATCGTCGGCT
CGCTGTTCAACGATGTTCATCAGTACCCCTGCCCCTACCTCATCACCCTGGGCGTGATGACGCTCGACCA
GAATGCGGTCGAAACCCGGGCCGCACTGCGCGGTGCACGTGCAGCTCAGAACGCGAAGTCAAAGATGGCT
CCGTTGCAACCGGAACTCGCGCTGCAGGATCGGGATTGGCGAGCAGTCGGACTTCAGCTCGAATCGGGTG
GCTCGATATGCGAGCTATACCACACGCTGACGCTCTTTGCGCCCCGCGACGGCATCGAGCGGTGCGTGGC
CGCGGCGCGCGGTATCTGGCGCTCGGAGCGGTTCAAGCTGTTTCCGATGGTCACGCAGCAGCTCACCACG
CTTCTGTCCGCGATGCCGATGGCCTTGACGCCAGATCTGCGCGACGACCTCAACAAGCTTCGCTTGATCT
CGACCAAAACCACCGTCAATGCGACCGATATGGCGCCGGTCGTTGCCGAATGGGGCGGGACTCGCGGTGC
TCCTTCGTTACTGTTTTACGGGCGTCGTGGGACCCCAGCACTGATCGATCTGTACTCGAGCCCGACGAAC
TACAACGGCTTCGTCGACGGCACCACGGGCGCCGGTAAATCGGTGCTGATGAATGAGATTATCGCGGCCT
TCCGGTCGGTCGGCGGAATCGTGCGCGTTTGCGACGTGGGCTATTCCTACGAGAAGCAAATCTCCCTCGC
AGGCGGCCAGTACATCGACTTCAAGCCGAACTCGGGGATCGTCATCAACCCCTTTTCGTCTGCCGGGTTT
GATCCCGAGAACGGTATCGATCAGGAGGTTAAGTTCATTCGGCCGATCATCGCGCGCATGGTCTCCCCGA
CTGCGCCGATCGAACAATTTGAGGGTGCGCTACTCGATCTTGCCGTCCGCCAGGTCTGGCAGGACTACGG
GCGCGATGGCAGCCCCACGCTGGTCAGTAAAGCCCTTCTGTCGCTCAAGGACCAAAACAAGCGACCGGAA
CGGGTGGCCTACGAGTTGTCGGTCCGACTTGGACCATTTTGCGACGGTGGTGTCTATGGTCGCTACGTGA
ACGGCCCGACCAATGTTCGCCTCGACAACGAGATCATCGGGTTGGAACTCGAGCACCTCAACAGCGACCC
GGACCTGCGAACCGTGATTTTGCTGGGGCTGACGAACCAGGTCACGAACGAGATGTACCGGTTTGACCGC
TCCCGCAAGAAGCTCTTCCTCACGGACGAGGGCTGGCAGGTCGTTGGCGATGACAAGGAAACCGCCGAGT
TCATGGAGGAAGGCTATCGCCGAGCGCGCAAGTACGAGGGGAGCTTTTTCTTCGGAACGCAGGGGATTGG
CGATACCAAGCTGAATCGAGCCATCCAGGCGGCATTCGATTTCTCCGCGTGGAAATTTCACATGGCGCAG
GGGAAGGACGCCATCCCAAAGATAGAGCGCGAGAAATCGATCGACCTCTCACCGAGTCTGAAAAAGATGC
TCTCATCGCTTGCACCGTACCCCGGGCGGTACAGCGAGTTCGTCCTCGTCGACCCGAACGGTGACGAGCA
TCTTCTGCGCCACATCCCCGAGGAATTCACCCTCGCCATGGCTACCACCAAGGGGCCGGACTACAACTTC
ATGCAACGACTGATTCAGCAGGGCGTGTCCACCGAGGACGCGATCCGCTCGCTCATCGAGCACAAACGGA
GCCGAGCATGA
 Primer design