SecReT4
Protein ID: 238023424
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0300
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]34638..35336 [-]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDC5ANL3
KEGG IDbgl:bglu_3p0300, bgl:bglu_4p0350
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 9.4e-29, Aligned region: 33..155
Protein Sequence: 232 a.a.     [Download]
>gi|238023424|ref|YP_002907657.1| type IV conjugative transfer system protein TraV [Burkholderia glumae BGR1]
MSIPYLTATRATAVIGAAVLALSACSFTGYDASSSFACKAPAGVLCNSMSGIYANAMAHNLPDQRVHAGS
GAATNLTLGSYADDSPADRASGSRKAAAGGARATSPGILPRALDSGAPVRTAPRELRVWFAPWQDADSDL
HDQEYVYLVVDPGHWSIAHNQARIRAAFQPVLPPVLSPTAAAAQGDAKDAGTAARRDAFTTPASNADRVM
QGILTPDGAIDRAAAMSPSADR
 
Nucleotide Sequence: 699 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c35336-34638 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGTCTATTCCCTACCTCACCGCGACGCGTGCGACGGCCGTTATCGGCGCCGCCGTGCTCGCGTTGTCCG
CCTGCAGCTTCACCGGGTATGACGCCAGTTCGTCGTTCGCGTGCAAAGCGCCTGCCGGCGTGCTCTGCAA
CAGCATGTCGGGCATCTACGCCAACGCCATGGCCCACAACCTCCCCGATCAGCGCGTGCACGCCGGCAGC
GGCGCGGCGACCAACCTGACGCTCGGGAGCTACGCCGACGACAGCCCGGCCGATCGCGCGTCAGGCTCGC
GCAAGGCGGCGGCCGGTGGCGCCCGCGCCACTTCCCCCGGCATCCTGCCGCGTGCCCTCGATAGCGGTGC
ACCGGTGCGCACGGCGCCGCGCGAACTGCGTGTCTGGTTCGCGCCCTGGCAGGACGCGGACTCGGACCTT
CACGACCAGGAGTACGTGTACCTCGTCGTCGACCCCGGCCACTGGTCCATCGCCCACAACCAGGCGCGCA
TCCGTGCCGCGTTCCAGCCGGTGCTGCCCCCTGTGTTGAGCCCCACCGCGGCGGCTGCTCAGGGTGACGC
CAAGGACGCCGGCACGGCAGCAAGGCGGGATGCGTTCACGACGCCCGCCTCGAATGCGGACCGTGTCATG
CAGGGCATCTTGACGCCGGATGGTGCGATAGACCGTGCGGCCGCGATGTCGCCGTCGGCCGATCGCTGA
 Primer design