SecReT4
Protein ID: 238023428
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0340
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]38601..39938 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDC5ANL7
KEGG IDbgl:bglu_3p0340
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.4e-35, Aligned region: 217..415
Protein Sequence: 445 a.a.     [Download]
>gi|238023428|ref|YP_002907661.1| TraB pilus assembly family protein [Burkholderia glumae BGR1]
MTDPNEANKKRQKIISMVVFGLLAALLVVGLLFTRQGKGPQQATTSVPFAHVGDQNDKNAWRAQSEAQFA
DMKKKLDAANGKADEATEKLKQVVQAQEDLKKQFDDQKKAGSGSAASAPAAASSTALDRALLNKPIPLNG
QQAKSGAILNPPFGQNARGAAMDVAAPPPKLDIINFDSPKKAGDDCVDPRFSSLPIDQAKQAQQDCLKAN
GKKGVTFIPATAFVRVFMMNGVDAPTGGEAQHDPLHVFLEVLDLANLPNARKLDITGCRILTSAYGDVSS
ERTMMHGETLACILKNGRTVEMTIKGTVMGEDGKEGVRGRLVSKSGSALAMSVLAGISSGIGQAFSQSAN
TLNTTALGTTSIVNPSQVGRSAIGSGVSQGADSLKQYYIRAAEKLFPVIETDGGRVVEFAVMKGAEYNGA
LSDVSDINDGLANGGRETDGGYSDE
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c39938-38601 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGACTGACCCGAACGAGGCAAACAAGAAGCGCCAGAAGATCATCAGCATGGTGGTCTTCGGGCTCTTGG
CCGCGCTGCTCGTCGTTGGCCTTCTCTTCACGCGCCAAGGCAAGGGACCGCAGCAGGCGACTACGTCGGT
CCCGTTCGCGCACGTCGGCGATCAGAACGACAAGAACGCGTGGCGTGCGCAGTCCGAGGCGCAATTTGCG
GACATGAAGAAGAAGCTCGACGCCGCGAATGGGAAGGCGGATGAGGCAACGGAAAAACTGAAGCAGGTCG
TCCAGGCGCAGGAGGACCTCAAGAAGCAGTTCGACGACCAGAAGAAGGCGGGCTCAGGTAGCGCCGCGAG
TGCCCCTGCTGCTGCCTCGTCGACAGCGCTCGACCGCGCGCTGCTCAACAAGCCGATTCCCTTGAACGGG
CAGCAGGCGAAGTCCGGCGCGATCCTGAATCCGCCGTTCGGCCAGAACGCGCGTGGCGCCGCTATGGACG
TGGCGGCGCCGCCCCCGAAGCTCGACATCATCAATTTCGATTCGCCCAAGAAGGCCGGTGACGACTGCGT
CGATCCCCGGTTCTCGTCGTTGCCCATCGACCAGGCCAAGCAAGCTCAGCAGGATTGCTTGAAGGCCAAC
GGCAAGAAGGGCGTGACCTTCATCCCCGCTACCGCTTTCGTACGGGTTTTCATGATGAACGGCGTTGATG
CACCGACCGGCGGGGAGGCGCAGCACGACCCGCTGCACGTCTTCCTCGAGGTGCTCGATCTCGCCAATCT
GCCGAATGCACGGAAGCTCGACATCACCGGATGCCGCATCTTGACCTCTGCCTACGGAGACGTCTCGAGC
GAGCGGACGATGATGCACGGCGAGACGCTCGCCTGCATCTTGAAGAACGGCCGGACCGTTGAGATGACCA
TCAAGGGCACTGTCATGGGCGAGGACGGCAAGGAGGGAGTCCGCGGTCGCCTCGTTTCCAAGTCTGGCTC
CGCCCTCGCCATGTCTGTGTTGGCCGGGATCTCGTCCGGGATCGGCCAAGCATTCAGCCAATCCGCCAAC
ACCTTGAACACCACGGCCCTCGGTACGACGTCGATCGTCAATCCGAGCCAGGTTGGTCGTTCCGCAATCG
GCAGCGGGGTATCGCAGGGAGCGGACTCCCTCAAGCAGTACTACATCCGCGCTGCCGAAAAGCTCTTCCC
GGTGATTGAAACCGACGGCGGCCGCGTGGTCGAGTTCGCCGTGATGAAAGGCGCGGAATACAACGGCGCC
CTCTCCGATGTCAGCGATATCAACGACGGCCTCGCCAATGGTGGCCGTGAAACCGATGGAGGCTACTCCG
ATGAGTGA
 Primer design