SecReT4
Protein ID: 238023429
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0350
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]39931..40671 [-]
ProductTraK
Component typeTraK_F
UniProt IDC5ANL8
KEGG IDbgl:bglu_3p0350, bgl:bglu_4p0400
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.6e-24, Aligned region: 22..238
Protein Sequence: 246 a.a.     [Download]
>gi|238023429|ref|YP_002907662.1| TraK [Burkholderia glumae BGR1]
MKPLYLRRRGVARLMLPLVAPLAALFVAGPASAISIVKGADRQAQQVFVSAAEYNLLTMSGGRQITKVVP
TVPGSLAWTQAGNQFWFKPSNPTALNETITIFVFDDAGVSYRLSLVPGPRPAEDVRIQPPASSTGRALRA
SAFQRHVKLLILAMSGAQSVPQVAYTSVETAVPLWKEATLTRVREYSDGDLVGETYTLANTSHNDLSLDE
RELYAPGVLAVAIEDANLPAGASTIVYVVRERGDHD
 
Nucleotide Sequence: 741 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c40671-39931 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGAAACCACTCTACCTTCGTCGCCGCGGTGTCGCGCGGCTCATGCTCCCACTCGTCGCACCGCTCGCCG
CGCTGTTCGTCGCCGGGCCTGCCAGCGCGATCTCGATCGTCAAGGGCGCGGACCGGCAAGCTCAGCAGGT
CTTCGTCTCAGCCGCCGAGTACAACCTGCTCACGATGTCGGGCGGCCGGCAGATCACCAAGGTGGTACCG
ACCGTTCCCGGATCGCTGGCGTGGACGCAGGCGGGCAACCAGTTCTGGTTCAAGCCGTCCAACCCCACCG
CGCTCAACGAAACCATCACGATATTTGTGTTCGATGACGCGGGCGTCAGCTACCGCCTTTCGCTGGTGCC
CGGTCCACGGCCGGCCGAGGACGTCCGTATCCAGCCGCCCGCCTCGAGCACAGGCCGCGCGCTGCGCGCC
TCCGCGTTCCAGCGTCACGTCAAGCTCTTGATTCTGGCGATGTCCGGTGCCCAGTCCGTGCCGCAGGTCG
CGTATACGTCCGTCGAGACGGCCGTGCCGCTCTGGAAAGAGGCGACGCTCACCCGCGTTCGCGAGTACAG
CGATGGTGACCTGGTGGGCGAGACGTACACGCTCGCGAACACCTCGCATAACGACCTGTCGCTCGACGAG
CGCGAGCTGTATGCGCCCGGGGTGCTGGCCGTAGCTATCGAGGATGCCAATCTTCCCGCCGGCGCCAGCA
CGATCGTCTATGTGGTTCGCGAGCGAGGCGACCATGACTGA
 Primer design