SecReT4
Protein ID: 238023430
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0360
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]40668..41279 [-]
Producttype IV conjugative transfer system protein TraE
Component typeTraE_F
UniProt IDC5ANL9
KEGG IDbgl:bglu_3p0360
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.6e-19, Aligned region: 6..184
Protein Sequence: 203 a.a.     [Download]
>gi|238023430|ref|YP_002907663.1| type IV conjugative transfer system protein TraE [Burkholderia glumae BGR1]
MTPDKAAASRDALRSQIRFLKKLLLVNGSSSVVIALVCAWLMMTQRVVIMPPAVRGTYVIGARYANDEYL
ADQAAYVLSLAKSVTPNTVDSNERILLSMVSDGRRAELKTQWDADALQLKHDGVTSVAEPAGSAEVDLRS
KSVKFPATISTYISGKLTSTEQKTFVVYFDISMFGRLTLLDIREAQRGTKGIEPLVPPAQKAS
 
Nucleotide Sequence: 612 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c41279-40668 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGACGCCAGACAAGGCTGCCGCATCCCGAGATGCACTGCGCTCCCAGATCCGTTTCCTAAAGAAGCTCC
TGCTGGTCAACGGGTCGTCGAGTGTGGTGATCGCGCTCGTCTGCGCATGGCTGATGATGACTCAGCGCGT
CGTCATCATGCCGCCGGCCGTGCGCGGCACGTATGTGATTGGTGCGCGCTACGCGAACGACGAATACCTC
GCCGATCAGGCAGCCTACGTGCTCTCCCTGGCCAAGAGCGTGACGCCCAATACGGTCGACAGCAACGAGC
GAATCCTCCTGTCGATGGTCAGCGATGGACGCCGCGCCGAATTGAAGACGCAATGGGACGCCGACGCGTT
GCAGCTCAAGCACGACGGCGTCACCAGCGTCGCCGAGCCCGCGGGCTCGGCCGAGGTCGACCTCCGCAGC
AAGTCGGTCAAGTTCCCCGCCACCATCAGCACCTATATCTCCGGCAAGCTCACGAGCACCGAGCAAAAGA
CGTTTGTCGTCTATTTCGATATCTCGATGTTCGGGCGCCTCACGCTCCTCGATATCCGCGAAGCACAACG
CGGCACGAAAGGCATCGAACCGCTTGTGCCGCCGGCGCAGAAGGCATCATGA
 Primer design