SecReT4
Protein ID: 238023431
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0370
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]41284..41571 [-]
ProductTraL
Component typeTraL_F
UniProt IDC5ANM0
KEGG IDbgl:bglu_3p0370, bgl:bglu_4p0420
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.7e-15, Aligned region: 8..93
Protein Sequence: 95 a.a.     [Download]
>gi|238023431|ref|YP_002907664.1| TraL [Burkholderia glumae BGR1]
MSEDLNHYVPSRLDDPEKFLFFRKDVASIGMGGVVGGIMLNHVLAGVTLGVALAYGWQKFSSGKHPGMST
HVAYWVIGRPTLKVLPASAIRELNG
 
Nucleotide Sequence: 288 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c41571-41284 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGTCCGAAGACCTCAACCACTACGTACCGAGCCGGCTCGACGATCCGGAAAAATTCCTGTTTTTCCGGA
AGGACGTCGCCTCGATCGGCATGGGCGGTGTCGTGGGCGGCATCATGCTCAACCATGTGCTCGCCGGTGT
CACGTTAGGCGTCGCGCTTGCCTACGGGTGGCAGAAGTTCAGCTCGGGCAAACATCCCGGGATGTCGACA
CACGTCGCGTACTGGGTCATCGGCCGGCCTACGCTCAAGGTGCTGCCGGCGTCCGCGATTCGCGAACTGA
ACGGGTGA
 Primer design