SecReT4
Protein ID: 238023434
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0400
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]42553..43047 [-]
Productlytic transglycosylase catalytic subunit
Component typeOrf169_F
UniProt IDC5ANM3
KEGG IDbgl:bglu_3p0400
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 164 a.a.     [Download]
>gi|238023434|ref|YP_002907667.1| lytic transglycosylase catalytic subunit [Burkholderia glumae BGR1]
MVGGIVGFVALAAHFSSTASASVCHGDPFVAAAAIYQLDPDLLRAITWVESRGIPSAVGPKLSGGHRAWG
AAQINDIHLPELVSYGVTREDLLDPCVNLKLSAWVLANCIRSKGATWAAVGCYNAGPASSNTTAQAKYVR
LVQRAYAGYRAQSAAATSASGRVK
 
Nucleotide Sequence: 495 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c43047-42553 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
CTGGTGGGAGGCATCGTCGGCTTCGTCGCGCTCGCCGCGCATTTCAGCAGCACGGCGTCGGCGTCGGTTT
GCCACGGCGATCCGTTCGTCGCCGCGGCCGCGATTTATCAGCTCGACCCAGACTTGCTTCGTGCAATCAC
ATGGGTAGAGTCTCGCGGCATTCCCAGCGCCGTTGGCCCGAAGCTCTCCGGTGGCCACCGTGCCTGGGGG
GCGGCGCAGATCAACGACATCCATCTGCCTGAACTCGTCTCCTACGGCGTGACCCGCGAAGATCTGCTTG
ATCCTTGCGTCAACCTGAAGCTGAGCGCCTGGGTGCTGGCCAACTGCATTCGCAGCAAGGGCGCCACCTG
GGCCGCAGTGGGTTGCTATAACGCTGGCCCCGCATCCTCGAATACCACTGCCCAGGCCAAGTATGTGCGG
CTTGTCCAACGTGCGTACGCCGGCTACCGGGCGCAGTCCGCTGCCGCGACGTCGGCAAGCGGGAGAGTGA
AATGA
 Primer design