SecReT4
Protein ID: 238023445
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0520
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]56412..59333 [-]
ProductTrwC protein
Component typeTraI_F
UniProt IDC5ANN4
KEGG IDbgl:bglu_3p0520
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 2.5e-88, Aligned region: 10..294
AAA_30 [PF13604], Evalue: 1.4e-46, Aligned region: 434..609
Protein Sequence: 973 a.a.     [Download]
>gi|238023445|ref|YP_002907678.1| TrwC protein [Burkholderia glumae BGR1]
MMSMHNVGIAGQALHYFSKDNYYTTEQGLERSQWFGKGAAALGLDGQVDEKEFFELLSGRVAGKQLGRVG
RDDNGQPDWVHRPGIDLTFSAPKSVSIAAEVFEDHQVRLAHEEAVKEALEYVEEYAAQARKTVDGETIAE
ETGNIVAALFRHNTSRDLDPDTHTHAVILNATRREDGQWRALTNDELYLQQKVIGAVYTASLARALQKRG
YAITAPDKNGNFELVGVTREQIEHFSQRSAARDRWLRANGIDPANATPAEKERAVLATRERKRDVDHAVL
SETWRERAQSVGLDYGAIQAKAREAREAGTDARVVEMSGIDALRFSAAHLGEREIVLNRYDMVKTAIEHA
VGRTSPAAILKAYGKLVEDGKIVNLPDGNITTEKMLNTERWTVEQALSQQGKTPAIAPLDVVRARIDHAI
EAARAERNAPDFDYTTGQRAAIELALTSEDRIVAVQGLAGVGKTTMVKGTVQVAHERGYVVRGMAATGKA
ALQLAADGGINADTVTMFEIHEQRRQDDLKLLREYVPDMKREPELWLVDESSFLAQRQMARLIKMAERAE
AKVILLGDKLQLQAIEAGKPFEVLQDEGLTTALMTQIQRQRNPELQQAVAITVGTADLAPDEELTSLDLS
RNARAFDFLEQAGRVIEIPDGEQLVQNLARRYVERGDRRNETIIITPFNEDRVNINNAIRSQLQARGELD
TQESDHTIFRSESEMTRAKQKEAQYYTTDMTVRFGRDYQKILAARGEYMTVVATRPDEGIVVLRKADGSL
MEWEPKKYNRVEIYLSEERALAARDVIRFTRGDELVKNGHEATVVSIQGSQAILRLADGKEIPWDLDAQR
HWDHAYAVTVHAGQGATREQAILHIPSEKLGRDPDDPRRQSDIAMTVRRIFGDRSFYVGITRAVDDLQIY
TTGAETARWAVSQHQDKSSALQTLREHEEAQLANPSLQPQPVNAAPQPRRQQQVLQQTQFDLD
 
Nucleotide Sequence: 2922 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c59333-56412 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGATGAGCATGCACAACGTAGGCATTGCCGGCCAGGCGCTGCACTACTTCTCCAAGGACAACTACTACA
CCACCGAGCAGGGCCTCGAGCGCTCTCAATGGTTTGGTAAGGGTGCCGCCGCGCTCGGGCTCGACGGCCA
GGTTGATGAGAAGGAATTCTTCGAGCTGCTCTCCGGCCGCGTCGCCGGTAAACAGTTGGGCCGCGTCGGG
CGCGACGATAATGGCCAGCCGGACTGGGTCCACCGCCCGGGAATCGATCTGACGTTTTCCGCGCCCAAGA
GCGTCAGCATCGCGGCCGAGGTGTTCGAGGATCACCAGGTGCGCCTCGCGCACGAGGAGGCCGTCAAGGA
GGCGCTCGAGTACGTTGAGGAATATGCCGCCCAGGCTCGCAAGACGGTCGACGGCGAGACGATCGCCGAG
GAGACGGGGAACATCGTCGCCGCCCTGTTCCGCCACAACACGAGCCGCGACCTGGACCCGGACACCCACA
CGCACGCCGTGATCCTCAATGCCACGCGACGCGAGGACGGGCAATGGCGCGCGCTCACGAATGACGAGCT
GTACCTGCAGCAGAAGGTCATCGGCGCCGTCTATACGGCCTCGCTCGCTCGCGCCTTGCAGAAGCGCGGC
TATGCGATCACGGCGCCGGACAAGAACGGCAACTTCGAGCTGGTGGGCGTCACCCGCGAGCAGATCGAGC
ATTTCAGCCAGCGATCCGCCGCGCGTGATCGCTGGCTCCGGGCGAACGGGATCGACCCGGCCAACGCGAC
TCCGGCAGAGAAGGAGCGCGCGGTGCTCGCCACCCGCGAGCGCAAGCGCGACGTTGACCACGCCGTGCTC
TCGGAGACCTGGCGCGAGCGCGCGCAGTCCGTCGGCCTGGATTACGGCGCCATCCAAGCGAAGGCTCGCG
AGGCGCGGGAGGCCGGCACCGATGCCCGCGTGGTCGAAATGTCAGGCATCGACGCGCTCCGGTTCTCGGC
CGCCCACCTGGGTGAACGCGAGATCGTCCTGAACCGGTACGACATGGTCAAGACCGCCATCGAGCACGCC
GTTGGCCGCACATCTCCGGCTGCGATCCTGAAGGCGTACGGCAAACTGGTCGAGGACGGCAAGATCGTCA
ACCTGCCGGACGGCAACATTACTACCGAGAAGATGTTGAACACCGAACGCTGGACAGTCGAGCAGGCCCT
GTCCCAGCAAGGCAAGACCCCGGCGATCGCGCCACTTGACGTCGTTCGCGCACGCATTGACCACGCCATT
GAGGCCGCTCGGGCCGAACGCAATGCCCCGGATTTCGACTATACGACCGGCCAGCGAGCGGCGATCGAGC
TCGCCCTGACCAGCGAGGACCGCATCGTCGCCGTGCAGGGGCTCGCCGGCGTCGGTAAGACCACGATGGT
CAAGGGCACCGTCCAGGTGGCGCACGAGCGCGGCTACGTCGTTCGCGGGATGGCGGCCACCGGCAAGGCC
GCGTTGCAACTCGCGGCCGATGGCGGGATCAATGCCGACACCGTCACGATGTTCGAAATCCACGAGCAGC
GCAGGCAGGATGACCTGAAGCTGCTGCGCGAGTATGTCCCGGACATGAAGCGCGAGCCCGAACTCTGGCT
CGTCGATGAGTCGTCGTTCCTCGCTCAGCGCCAGATGGCCCGCCTGATCAAGATGGCCGAGCGAGCCGAG
GCCAAGGTCATTCTGCTCGGTGACAAGCTGCAGCTGCAGGCCATCGAGGCCGGTAAGCCCTTCGAGGTCT
TGCAGGACGAGGGGCTAACGACGGCGCTCATGACGCAGATCCAGCGTCAGCGAAACCCCGAGCTGCAGCA
GGCGGTGGCGATCACGGTCGGCACCGCAGACCTGGCACCCGACGAGGAACTGACCAGCCTGGATCTCAGC
CGCAATGCCCGCGCCTTCGATTTTCTCGAGCAAGCCGGCCGCGTCATTGAAATCCCCGATGGGGAGCAGC
TGGTGCAAAATTTGGCGCGCCGGTACGTCGAGCGAGGCGATCGACGCAACGAGACCATCATCATCACGCC
ATTCAACGAGGACCGCGTCAACATCAACAACGCGATTCGGTCTCAGCTACAAGCGCGCGGCGAGCTTGAC
ACGCAGGAGTCGGACCACACGATTTTCAGGTCCGAAAGCGAAATGACCCGGGCCAAGCAGAAGGAGGCGC
AGTATTACACCACGGACATGACCGTGCGGTTCGGCCGAGACTACCAGAAGATCCTCGCGGCCCGCGGCGA
ATACATGACAGTCGTCGCGACCCGACCGGACGAAGGCATTGTCGTGCTCCGCAAAGCCGATGGCTCGCTG
ATGGAGTGGGAGCCGAAGAAATACAACCGCGTCGAGATCTATCTCTCGGAGGAGCGCGCGCTGGCGGCTC
GCGACGTCATCCGCTTTACGCGCGGCGACGAATTGGTCAAGAACGGTCACGAGGCGACGGTGGTCTCCAT
CCAGGGCAGTCAGGCCATCCTTCGTCTCGCGGACGGTAAGGAGATCCCGTGGGATCTCGACGCACAGCGG
CATTGGGATCACGCCTATGCGGTAACCGTCCACGCTGGCCAGGGCGCGACGCGCGAGCAGGCCATCCTGC
ACATCCCGTCCGAAAAGCTCGGGCGTGACCCAGACGACCCACGCCGGCAGTCCGACATTGCGATGACCGT
GCGGCGCATTTTCGGTGACCGCAGTTTCTACGTCGGCATCACCCGCGCCGTCGACGATCTGCAGATCTAC
ACCACAGGCGCCGAGACTGCCCGCTGGGCCGTCAGTCAGCATCAGGACAAGTCGAGCGCTCTGCAGACGC
TTCGCGAGCATGAGGAGGCTCAGTTGGCTAACCCATCGCTGCAACCGCAGCCGGTCAACGCGGCGCCGCA
GCCTCGGCGGCAACAGCAGGTGCTACAGCAGACTCAGTTCGATCTGGATTGA
 Primer design