SecReT4
Protein ID: 238023446
T4SS name [ID]Tra_F [521]
Gene symbol-
Locus tagbglu_3p0530
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_3p [GenBank: NC_012720] [Browse all T4SS(s) in this replicon]
Location [Strand]59343..61409 [-]
Producttype IV secretion system protein TraD
Component typeTraD_F
UniProt IDC5ANN5
KEGG IDbgl:bglu_3p0530
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.9e-137, Aligned region: 171..554
TraG-D_C [PF12696], Evalue: 2.6e-16, Aligned region: 414..535
T4SS-DNA_transf [PF02534], Evalue: 3.4e-12, Aligned region: 361..556
AAA_10 [PF12846], Evalue: 5.7e-07, Aligned region: 184..490
Protein Sequence: 688 a.a.     [Download]
>gi|238023446|ref|YP_002907679.1| type IV secretion system protein TraD [Burkholderia glumae BGR1]
MTNARAPSTSATFSRGIALWWQQAKLFASGVLFVLVGSLIAGILVAAGSLFLATSSDDRYLALKHLQADL
LTVVPMANRTINFNFDSGGTSMQPAEALAFTQDAADSVNVEIYNAALYGTLAAIGCFVIATIFWMEYGRK
RLTDHQVRGARLVKAKQLKSELVARNDASPYRIADVPMRKGAENLNTLIAGAQGTGKSRQFFELMRQVRA
RGKKAVVYDSSGEFTAAFYREGKDIILNPLDARSPNWNPWREIHGEIHYDNIAEALIPLPPKDPQPFFAI
AARMVFKDSLRALGKSNKRTNADLYNAISRSNLDELHALLIREAAATYVDPVTERTGMSLKMTVQNQLDS
FRFLHDEGDPFSIREWTQKEDDDSWLFITVNEEQKSALLPLISLWCDIAIQALLSLKPIHEERIWYFYDE
LPGLQKLEIMKVAVTGTRKFGGCFVLGLQDFLQLFEIYGDYLARTIISGCQTKLLLRVTDGDSAKALVNA
IGQADLDEKEESFNLGIDERRDGMSVFAKRNLRDIVLSSEILHLPDMQGYLVTPSDYPIARVKYRYVPFP
QVATPFVPRQDPGLWIPPSAVSSPPVAVPAPAASSSSATAPSQPAPAASTDPVASPPPSAGSAAPAASTS
TAVGARTAPAAAAPANLIMLPSGDVVDADTGEVQGRASGQSRGTSSAPDDSTGNFDLF
 
Nucleotide Sequence: 2067 bp     [Download]
>gi|339717136|ref|NC_012720.2|:c61409-59343 Burkholderia glumae BGR1 plasmid bglu_3p, complete sequence
ATGACTAACGCCCGCGCTCCGAGCACCAGCGCCACCTTTTCTCGCGGCATCGCCCTGTGGTGGCAACAAG
CAAAACTCTTCGCCAGCGGGGTCCTCTTCGTCCTCGTCGGTTCGCTCATCGCAGGCATCCTCGTCGCGGC
CGGCTCGCTGTTTCTCGCCACTTCTTCCGACGACCGGTATCTCGCGCTCAAGCATCTCCAGGCCGATTTG
CTCACAGTCGTGCCGATGGCCAACCGCACGATCAACTTCAATTTCGACTCCGGCGGCACCTCCATGCAGC
CCGCCGAGGCGCTCGCTTTTACGCAAGACGCCGCCGACTCGGTCAACGTCGAAATCTACAACGCGGCTCT
CTACGGCACGCTGGCCGCCATCGGCTGCTTCGTCATCGCCACGATTTTCTGGATGGAGTACGGCCGCAAG
CGACTCACCGATCATCAGGTCCGTGGCGCTCGCCTGGTCAAGGCAAAACAGCTCAAATCCGAATTGGTGG
CTCGCAACGACGCGAGCCCCTATCGCATCGCCGACGTGCCGATGCGCAAGGGTGCCGAGAACCTTAACAC
CCTCATCGCCGGCGCTCAGGGAACCGGCAAGTCCCGGCAGTTTTTCGAACTCATGCGGCAGGTACGCGCA
CGTGGCAAGAAGGCCGTCGTCTACGATTCCTCCGGCGAGTTCACCGCTGCGTTTTACCGAGAAGGGAAGG
ACATCATCCTCAACCCGCTCGATGCGCGCAGTCCGAACTGGAACCCTTGGCGAGAAATTCACGGCGAGAT
CCACTATGACAACATAGCGGAAGCGCTCATTCCACTGCCACCAAAGGACCCGCAACCCTTTTTCGCGATC
GCGGCTCGCATGGTATTCAAGGATTCGCTTCGAGCGCTCGGTAAATCCAACAAACGAACGAACGCCGATC
TATATAACGCCATCTCGCGCAGCAATCTCGACGAGCTTCACGCGCTTCTGATTCGGGAGGCTGCTGCCAC
CTACGTCGATCCGGTCACCGAGCGTACTGGCATGAGCCTGAAAATGACCGTCCAGAATCAGCTCGATAGT
TTTCGCTTCCTGCATGACGAGGGTGACCCATTTTCGATTCGGGAGTGGACGCAGAAGGAGGACGACGATT
CCTGGCTTTTCATCACGGTCAACGAAGAACAGAAATCCGCGCTCCTGCCGCTCATCAGTCTCTGGTGCGA
TATCGCGATCCAGGCGCTGCTGTCCTTGAAGCCGATTCATGAAGAACGCATCTGGTATTTCTACGACGAG
CTACCCGGTTTGCAGAAGCTGGAGATCATGAAGGTGGCCGTGACCGGCACGCGCAAATTCGGCGGCTGCT
TCGTTCTCGGCCTCCAGGATTTCTTGCAACTCTTCGAGATCTATGGCGATTACCTCGCCCGTACCATCAT
CTCCGGATGCCAGACCAAGCTACTCCTCCGTGTCACCGACGGCGATTCAGCAAAAGCGCTGGTCAATGCC
ATCGGCCAGGCGGATCTGGATGAAAAGGAAGAAAGTTTCAACCTGGGCATCGATGAGCGACGCGACGGAA
TGAGCGTTTTTGCCAAGCGCAATTTGCGTGACATCGTGCTGTCCTCCGAGATTTTGCATCTGCCCGACAT
GCAAGGGTATCTCGTGACCCCGAGCGACTATCCGATTGCGCGGGTCAAGTACCGCTACGTCCCGTTTCCG
CAAGTCGCCACCCCCTTCGTGCCGCGCCAAGATCCAGGCTTGTGGATTCCGCCGTCAGCGGTCTCGAGCC
CGCCGGTCGCGGTGCCGGCCCCGGCCGCGTCGTCGTCCTCTGCGACTGCACCAAGCCAACCGGCGCCAGC
GGCATCGACTGACCCGGTTGCCTCTCCCCCGCCTTCTGCTGGCTCGGCCGCGCCTGCCGCTTCCACGTCC
ACGGCTGTCGGTGCCCGTACCGCGCCTGCCGCTGCCGCGCCGGCCAACCTCATCATGCTCCCGTCCGGAG
ACGTCGTCGACGCGGACACCGGCGAGGTCCAGGGGCGAGCCAGCGGCCAGTCGCGCGGCACCAGCAGCGC
GCCCGACGATTCCACCGGCAACTTCGACCTGTTCTGA
 Primer design