SecReT4
Protein ID: 238029000
T4SS name [ID]Tra_F [520]
Gene symbol-
Locus tagbglu_4p0240
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_4p [GenBank: NC_012725] [Browse all T4SS(s) in this replicon]
Location [Strand]27868..28680 [-]
Productconjugal transfer protein TraF
Component typeTraF_F
UniProt IDC5ANW2
KEGG IDbgl:bglu_4p0240
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.7e-71, Aligned region: 44..259
Thioredoxin_2 [PF13098], Evalue: 1.1e-05, Aligned region: 164..254
Protein Sequence: 270 a.a.     [Download]
>gi|238029000|ref|YP_002913225.1| conjugal transfer protein TraF [Burkholderia glumae BGR1]
MIATRLTAMIAPVVLAIIALTSPLAVADGVDYPSAWQCDGQAKFNWYCDDDDKPAAPAVASAAAPADPDD
FSRFKTADEMREALKHRLDLATMDPTEANVKSYKRLELYVMAKSATYADVSRRVVWQNPDLDYSLKRPTN
NVAVHTYDQARDNDQDAQLRALAEKHGLIFFFRHDCPYCHALAPTIRLLADRYGIDVLPVSLDGQGIPDF
PNPTADHGQAAIWGVQQVPALFIASKETGDHATIGSGVLSLQDIVDRIFVLTASKPGELF
 
Nucleotide Sequence: 813 bp     [Download]
>gi|339717962|ref|NC_012725.2|:c28680-27868 Burkholderia glumae BGR1 plasmid bglu_4p, complete sequence
ATGATTGCTACCCGTCTAACGGCAATGATAGCTCCGGTGGTGCTGGCGATCATTGCATTGACCTCGCCGC
TCGCCGTTGCTGACGGCGTGGACTACCCGTCCGCGTGGCAGTGCGACGGTCAGGCGAAGTTCAACTGGTA
TTGCGATGACGACGACAAGCCGGCGGCCCCGGCGGTCGCGAGCGCGGCCGCGCCGGCGGACCCCGACGAC
TTCTCCCGGTTCAAGACGGCCGATGAGATGCGTGAGGCGCTCAAGCACCGGCTCGACCTCGCGACGATGG
ACCCGACCGAAGCGAACGTCAAATCGTATAAGCGGCTCGAGCTGTATGTGATGGCAAAGAGCGCGACCTA
CGCGGACGTGTCGCGGCGCGTGGTCTGGCAGAACCCGGATCTCGACTACTCGCTCAAGCGGCCGACCAAC
AACGTTGCCGTCCACACCTACGACCAGGCGCGCGATAACGATCAGGACGCGCAGCTGCGCGCGCTCGCCG
AGAAGCACGGGCTCATCTTCTTCTTCCGGCACGACTGCCCGTACTGCCACGCGCTCGCCCCGACCATTCG
CTTGCTCGCGGATCGATACGGGATCGACGTGTTGCCGGTGTCGCTCGATGGCCAGGGGATTCCGGATTTC
CCGAACCCGACCGCGGACCATGGTCAGGCGGCGATTTGGGGCGTGCAGCAAGTGCCGGCGCTGTTCATCG
CGTCGAAGGAGACCGGCGACCACGCCACGATCGGCTCGGGAGTCTTGTCGCTTCAGGACATCGTCGATCG
CATCTTCGTTCTCACTGCTTCTAAACCTGGGGAGCTTTTCTGA
 Primer design