SecReT4
Protein ID: 238029018
T4SS name [ID]Tra_F [520]
Gene symbol-
Locus tagbglu_4p0420
StrainBurkholderia glumae BGR1
Repliconplasmid bglu_4p [GenBank: NC_012725] [Browse all T4SS(s) in this replicon]
Location [Strand]45858..46145 [-]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDC5ANM0
KEGG IDbgl:bglu_3p0370, bgl:bglu_4p0420
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 1.7e-15, Aligned region: 8..93
Protein Sequence: 95 a.a.     [Download]
>gi|238029018|ref|YP_002913243.1| type IV conjugative transfer system protein TraL [Burkholderia glumae BGR1]
MSEDLNHYVPSRLDDPEKFLFFRKDVASIGMGGVVGGIMLNHVLAGVTLGVALAYGWQKFSSGKHPGMST
HVAYWVIGRPTLKVLPASAIRELNG
 
Nucleotide Sequence: 288 bp     [Download]
>gi|339717962|ref|NC_012725.2|:c46145-45858 Burkholderia glumae BGR1 plasmid bglu_4p, complete sequence
ATGTCCGAAGACCTCAACCACTACGTACCGAGCCGGCTCGACGATCCGGAAAAATTCCTGTTTTTCCGGA
AGGACGTCGCATCGATCGGCATGGGCGGTGTCGTGGGCGGCATCATGCTCAACCATGTGCTCGCCGGTGT
CACGTTAGGCGTCGCGCTTGCCTACGGGTGGCAGAAGTTCAGCTCGGGTAAACATCCCGGGATGTCGACA
CACGTCGCGTACTGGGTCATCGGCCGGCCCACGCTCAAGGTACTGCCGGCGTCCGCGATTCGCGAACTGA
ACGGGTGA
 Primer design