SecReT4
Protein ID: 238650734
T4SS name [ID]VirB [478]
Gene symbol-
Locus tagRPR_04245
StrainRickettsia peacockii str. Rustic
Repliconchromosome [GenBank: NC_012730] [Browse all T4SS(s) in this replicon]
Location [Strand]721528..722226 [-]
ProductvirB8a protein
Component typeVirB8
UniProt IDC4K1T8
KEGG IDrpk:RPR_04245
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.9e-18, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|238650734|ref|YP_002916587.1| virB8a protein [Rickettsia peacockii str. Rustic]
MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTIFTLLLTLICININILLPINKKVNYL
IKDDAEKQAAVTNTKHSTLVKPYTSIANIMLQNYVNQREEYNYDILKEQFTFIKNASTSIVYMQFANFMN
IDNPLSPVIRYQKLYRRSINILSINNINDNEAVVTFESLAKNSTDAILENMVWEARIGFIMDSISTNTSP
DMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|238650213|ref|NC_012730.1|:c722226-721528 Rickettsia peacockii str. Rustic, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCGGCGAATATTTTATTGATGCAAGAAAAT
GGTATAATTTTAAGTATATCTTACCGTTAAGTCATAGAAGTCTTCTGCTTCTAATATGCACGATTTTTAC
CTTATTATTAACCTTAATTTGTATAAATATCAACATATTGCTACCTATAAACAAAAAAGTAAATTATTTA
ATAAAAGATGATGCCGAAAAACAAGCTGCCGTTACTAATACTAAACATTCAACATTAGTAAAGCCTTATA
CCTCTATTGCAAATATTATGCTTCAGAATTATGTAAACCAACGAGAAGAATACAATTACGATATATTAAA
AGAACAATTTACCTTTATCAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTATATAGACGCTCAATTAATATATTATCAA
TTAACAATATAAACGATAACGAGGCAGTTGTTACTTTTGAATCATTGGCAAAAAATAGTACGGATGCAAT
TTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATGGATTCTATCAGTACAAATACATCACCT
GATATGCCGTTCAATTTTACCGTTACTAGTTACAAGCTAAAGTTATTAAGGAATAAAAATCAGAAATAA
 Primer design