SecReT4
Protein ID: 238650736
T4SS name [ID]VirB [478]
Gene symbol-
Locus tagRPR_04255
StrainRickettsia peacockii str. Rustic
Repliconchromosome [GenBank: NC_012730] [Browse all T4SS(s) in this replicon]
Location [Strand]722920..723651 [+]
ProductvirB8b protein
Component typeVirB8
UniProt IDC4K1U0
KEGG IDrpk:RPR_04255
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1e-44, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|238650736|ref|YP_002916589.1| virB8b protein [Rickettsia peacockii str. Rustic]
MNNIFGFFKSSNNSQSGSGDTQTQESIKSANPLKITQNWYEERSDKLLVQRNLLIILIILLTIFMVIATL
VIAFVVKSKQFEPFVIQLNSNTGRASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFATIARTTI
RLFSTSSVYYNYLGYIRNKDFDPTLKYKEENNTFLVIKSWSKIAADKYIVRFSVNETSGNQLVYNKIAVV
SYAYVPMQLTDSELDVNPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|238650213|ref|NC_012730.1|:722920-723651 Rickettsia peacockii str. Rustic, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAATAACTCGCAAAGCGGTTCAGGAGATACACAAACGC
AAGAAAGTATTAAATCGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
ACTTGTTCAACGTAACTTACTTATCATATTAATAATACTACTAACCATTTTTATGGTTATAGCAACTTTA
GTAATAGCCTTTGTAGTGAAATCTAAACAGTTTGAGCCTTTTGTTATTCAGCTTAATAGTAATACCGGAC
GTGCCTCAGTGGTAGAACCTATTTCATCACCAGTGTTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCGGTTGATTTTGCGACGATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCAGTGTGTATTACAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CTTTAAAATATAAAGAAGAGAATAATACATTTTTAGTAATCAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAGACATCAGGAAACCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGATGTAAATCCGGTAGGGTTTCAAGTGA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design