SecReT4
Protein ID: 238650739
T4SS name [ID]VirB [478]
Gene symbol-
Locus tagRPR_04270
StrainRickettsia peacockii str. Rustic
Repliconchromosome [GenBank: NC_012730] [Browse all T4SS(s) in this replicon]
Location [Strand]725740..726744 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDC4K1U3
KEGG IDrpk:RPR_04270
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.8e-93, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|238650739|ref|YP_002916592.1| type IV secretion system ATPase VirB11 [Rickettsia peacockii str. Rustic]
MSEEFAALETFLLPFKNLFAEDGINEIMVNKPGEVWVEKKGDIYSKQIPKLDSEHLLALGSLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYAIRKPSGMNLTLDEYAKMGAFDDTATESLVDEDAVIL
NNFLAEKKIKEFIRHAVVSKQNIIISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSHHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|238650213|ref|NC_012730.1|:725740-726744 Rickettsia peacockii str. Rustic, complete genome
ATGAGTGAAGAATTTGCAGCCTTAGAGACGTTTTTACTGCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAAATTATGGTTAATAAGCCCGGAGAAGTATGGGTTGAAAAAAAAGGTGATATATATTCTAAGCA
AATACCGAAACTGGATAGCGAACATCTACTTGCATTAGGGAGTTTAGTCGCTCAATCTACCGAACAGATG
ATTTCAGAAGAAAAACCGCTTCTTTCGGCAACTTTGCCGAATGGCTACCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATGCTATAAGAAAGCCTAGCGGTATGAATCTAACTTTAGATGA
ATATGCTAAAATGGGGGCATTTGATGATACTGCAACAGAGAGTTTAGTAGATGAAGATGCAGTAATTTTA
AATAATTTCTTAGCTGAAAAAAAGATTAAAGAATTTATTAGACATGCAGTTGTTTCAAAGCAAAATATCA
TAATTAGCGGCGGTACTTCAACCGGTAAAACTACTTTTACTAATGCGGCACTCACTGAAATACCTGCAAT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCACACCATCCTAACAGAGTGCATTTA
CTGGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCCTGTTTGCGTT
TAAGACCAGATAGGATTATAGTAGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCATCCCGGTTCAATATCAACACTGCATGCTGATAGTCCCGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAG
ATATCGTTGTGCAGTTAAAACGCGGTAGCGGCGGGAAAAGATATGTTTCGGAAGTATATTATAAGAAGAA
CAAGAACGCTGAGGGGATGGTTTAA
 Primer design