SecReT4
Protein ID: 238650740
T4SS name [ID]VirB [478]
Gene symbol-
Locus tagRPR_04275
StrainRickettsia peacockii str. Rustic
Repliconchromosome [GenBank: NC_012730] [Browse all T4SS(s) in this replicon]
Location [Strand]726899..728674 [+]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDC4K1U4
KEGG IDrpk:RPR_04275
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-165, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 8.9e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 1.3e-21, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 2.6e-05, Aligned region: 155..481
Protein Sequence: 591 a.a.     [Download]
>gi|238650740|ref|YP_002916593.1| type IV secretion system component VirD4 [Rickettsia peacockii str. Rustic]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVAIFTNEVGALGVNINAINIAYKWAYWLINVWGQLK
IADYNYLKLKLLASLLSPAIIVIIFYIKNFERIKSLQFFKQDEKVYGDASWANPSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGVTHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNIQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPYGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNATYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNIATRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFDPRANNNEASEETKTITVPENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|238650213|ref|NC_012730.1|:726899-728674 Rickettsia peacockii str. Rustic, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGAAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGTACCATTTGGATAAGCGGTGCATTTGTTGCAATTTTTACTAATGAGGTTGGAGCTTTAGGTGT
AAATATAAATGCTATAAATATTGCTTATAAGTGGGCTTATTGGCTTATTAACGTTTGGGGGCAGTTAAAA
ATTGCCGACTATAATTATTTAAAATTGAAGCTACTTGCCTCTCTTCTCAGTCCGGCTATTATTGTTATAA
TATTTTACATTAAAAATTTTGAAAGAATAAAATCATTACAATTTTTCAAACAAGATGAAAAAGTATATGG
AGATGCAAGCTGGGCTAATCCGTCAGATATAGAGGCTGCAGGTCTTAGATCTAAGAAAGGTATGCTGATC
GGTGTTGATGCCGGTGGATATTTTGTTGCAGACGGGTTCCAGCATGCTTTATTATTTGCTCCTACCGGTT
CAGGTAAAGGTGTAGGGTTTGTGATACCTAACTTGTTATTTTGGAGTGATTCGGTAGTAGTGCATGACAT
AAAGCTTGAAAATCACGGGTTGACAAGTGGTTGGCGTGAGAAGCAAGGGCAGAAAGTTTTTGTATGGGAG
CCTTCTAATCCTGATGGTGTTACTCATTGTTATAATCCGATTGATTGGGTTAGTACTAAGCCTGGGCAAA
TGGTTGATGACGTTCAAAAAATTTCAAATCTTATAATGCCGGAAAAGGATTTTTGGAATAATGAGGCACG
AAGCTTATTTTTAGGCGTAACTCTATATTTAATAGCCGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTGCGTACTATGAGGAGTGACGACGTAGTTTATAATCTAGCGGTCGTACTCGATACGCTTGGTGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCATTTTTGCAAAAAGCCGATAAAGAGCGTTCCGGCGTAAT
ATCTACAATGAACTCATCGCTTGAATTATGGGCAAATCCACTTATTGATTCAGCTACAGCATCTTCTGAT
TTCAATATACAAGAATTTAAAAAAGTCAAAACAACCGTATATGTAGGGTTAACACCCGATAATATACAGC
GTTTACAAAAATTAATGCAGGTGTTTTATCAGCAGGCGACAGAATTTTTAAGCCGCAAAATGCCGGATTT
AAAGGAAGAGCCGTATGGAGTAATGTTCTTACTTGACGAGTTCCCAACGCTCGGGAAGATGGATACTTTT
AAAGCCGGTATAGCTTATTTTAGAGGTTATAGAGTTCGTTTATTTTTAATTATCCAAGATACACAGCAGT
TAAAAGGAACATATGAAGATGCCGGGATGAATTCTTTCTTATCTAATGCAACATATCGTATTACTTTTGC
CGCTAATAACTATGAAACGGCAAATTTAATATCGCAGCTTGTCGGTAATAAGACGGTAGAACAAAGATCA
TTTAGTAAACCTTTATTTTTTGATCTTAATATTGCTACTAGAACCCAAAACGTTTCTCAGGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGCTACCGAGAGATGAGCAAATTGTTTTAATAGAATCCTTTCC
GCCTATAAAATCGCGTAAAATTAAGTATTATGAAGATAAGTTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCTTTTGACCCTAGGGCAAATAATAATGAGGCTTCGGAAGAGACCAAAACAA
TAACTGTTCCGGAAAATAATGAGTAA
 Primer design