SecReT4
Protein ID: 238892788
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0594
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]585240..586655 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDC4X2G0
KEGG IDkpu:KP1_0594
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 471 a.a.     [Download]
>gi|238892788|ref|YP_002917522.1| hypothetical protein KP1_0594 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MAALQMLPAPGTDFSRQYGLTEAVMRALILVLLFFAWVCAAADDYSFRTRGAVDDLLYYQIGGGEAVMPP
PVRRSPSPLSVGIGWNADMMCGNFDIGTTVRNQLNGITDGFQQLMGNVIQSATGAVASLPAMIIQRANPQ
LYDLLTNGVLQGRLDFDKSLLNCQKMAEKMTDLAADSAWFSGAKAENYQTLAASDSDAIRTDQKAAKEAA
EKGKRWVGGEKRGGKGQPPIKVVHDATAAGWNILNQQPATSTTSLTSSECDGELCSTWKSPEEAAGWMTR
VVGEQTISVAQATDDPDARSGAQAGIGLHPLIDEEKAKILLVLTALVNGNQKPGFDNLAKASGGSMQLTR
GVVEALRDDPDAAVLTERLAGELALARVTEQALLARRTLLAGMREPNIANVKEAQESLGKTTIQLDEELS
QLKLELDFRQALTRNTASQILQRKQQRDQLQGQAVEVPDDSDRRLHNLNNP
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c586655-585240 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
GTGGCGGCCTTACAAATGCTGCCCGCGCCGGGGACAGACTTTTCTCGGCAGTACGGGTTAACGGAGGCGG
TGATGAGAGCGCTTATCCTGGTCTTACTGTTTTTCGCCTGGGTTTGCGCGGCCGCCGATGACTACAGCTT
CCGCACGCGAGGCGCGGTCGACGACCTGCTTTACTATCAGATTGGCGGCGGCGAGGCCGTGATGCCTCCA
CCCGTTCGCCGCAGTCCCTCTCCGCTCAGCGTGGGGATTGGCTGGAACGCCGATATGATGTGCGGCAATT
TCGATATCGGCACCACCGTGCGCAACCAGTTGAACGGCATCACCGACGGCTTCCAGCAACTGATGGGCAA
CGTCATCCAGAGCGCCACCGGCGCGGTTGCCAGCCTGCCCGCGATGATTATTCAGCGCGCCAATCCGCAG
CTTTATGATCTGCTGACCAACGGCGTGCTGCAAGGGCGGCTGGATTTTGACAAATCGCTGCTGAACTGCC
AGAAAATGGCGGAGAAGATGACCGATTTAGCGGCCGATTCCGCCTGGTTTTCGGGAGCCAAAGCGGAGAA
CTACCAGACCCTTGCCGCCAGCGACAGCGACGCCATCCGCACCGACCAGAAAGCGGCAAAAGAGGCCGCC
GAAAAGGGTAAACGCTGGGTGGGCGGCGAAAAGCGCGGCGGTAAAGGCCAGCCGCCGATTAAGGTAGTCC
ATGACGCCACCGCCGCAGGCTGGAATATCCTCAACCAGCAGCCCGCCACCAGCACCACGTCTCTTACCTC
CTCTGAATGCGACGGGGAACTTTGTAGCACCTGGAAATCTCCTGAAGAGGCCGCCGGATGGATGACCCGC
GTGGTTGGCGAGCAGACCATCAGCGTGGCGCAGGCCACCGACGATCCGGATGCGCGTTCCGGCGCACAGG
CGGGGATCGGCCTGCATCCGCTGATCGACGAAGAAAAGGCGAAGATCCTGCTTGTGCTGACGGCTCTGGT
TAACGGTAACCAGAAGCCCGGCTTCGACAACCTGGCGAAAGCCTCCGGCGGATCCATGCAGCTTACCCGC
GGCGTGGTCGAGGCGCTGCGCGACGATCCGGACGCCGCCGTCCTCACCGAACGGCTGGCGGGAGAACTGG
CGCTGGCCCGCGTCACCGAACAGGCGCTGCTGGCCCGGCGCACGCTGCTTGCAGGTATGCGCGAACCGAA
TATCGCCAACGTCAAAGAGGCGCAGGAGAGCCTGGGCAAAACCACCATCCAACTGGATGAAGAGCTGAGC
CAGCTTAAGCTGGAACTCGATTTCCGCCAGGCGCTGACGCGCAATACCGCGAGCCAGATCCTGCAACGCA
AACAGCAGCGTGACCAGCTTCAGGGACAGGCGGTGGAAGTGCCGGACGACAGCGACCGCCGCCTGCACAA
TCTCAATAATCCGTAG
 Primer design