SecReT4
Protein ID: 238892809
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0619
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]606213..606566 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDC4X2I1
KEGG IDkpu:KP1_0619
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 9.7e-34, Aligned region: 2..115
Protein Sequence: 117 a.a.     [Download]
>gi|238892809|ref|YP_002917543.1| hypothetical protein KP1_0619 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MATIPFLPDRLNREPVVWRGLTTSELFLALASGLGGGCLSGILLALLSGYWPLIPGSALAGSALLIQGGG
RILARAKSGKPDSWLLLAILAWLERHHLRGTQLIQHSAVWVVRRSPR
 
Nucleotide Sequence: 354 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c606566-606213 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGCGACTATCCCCTTTCTCCCCGACCGCCTTAACCGCGAGCCCGTGGTCTGGCGCGGCCTGACCACCA
GCGAGCTGTTTCTGGCACTGGCAAGCGGTCTTGGTGGTGGTTGCCTATCCGGCATTCTGCTGGCCCTGCT
CAGCGGTTACTGGCCGTTGATCCCCGGCTCGGCGCTGGCAGGCTCGGCGTTGCTGATTCAGGGTGGTGGG
CGCATTCTGGCGCGTGCCAAAAGCGGTAAGCCCGACAGTTGGCTACTCTTAGCAATCCTTGCCTGGCTGG
AGCGTCATCATCTTCGGGGTACGCAACTGATCCAGCATAGCGCTGTGTGGGTGGTACGCAGGAGTCCGCG
ATGA
 Primer design