SecReT4
Protein ID: 238892814
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0625
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]614926..615558 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDC4X2I6
KEGG IDkpu:KP1_0625
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3.5e-23, Aligned region: 106..207
Protein Sequence: 210 a.a.     [Download]
>gi|238892814|ref|YP_002917548.1| hypothetical protein KP1_0625 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MSEQRTPPSRPPQGPIGWLLSLTGRLIGLVIGALVLRIVLELAGLYFWWPQEGSRHVFQVMNRERVELVI
ALQPHPLKDEIVMLLENGATRVLMPNWLLKKPFTGLAYTLVSFMQRLIWLAAMLPLLCLCVLIGLIEGLV
QRDLRRFGSGLKSVFLHRYVIRSGSSVATTLWVFYLAQPLFLPSMLILLPATLWFGVTVWIVAGSFKRWL
 
Nucleotide Sequence: 633 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c615558-614926 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAGTGAGCAGCGAACGCCTCCGTCACGCCCACCACAGGGACCAATTGGCTGGCTGCTGTCGCTGACCG
GGCGGCTCATCGGGCTGGTTATTGGTGCGCTGGTGCTGCGGATTGTATTGGAACTGGCGGGGCTGTATTT
CTGGTGGCCTCAGGAAGGGAGCAGGCATGTTTTTCAGGTGATGAACCGGGAGCGGGTGGAGCTGGTTATT
GCGTTACAGCCACATCCACTGAAGGATGAAATTGTCATGCTGCTGGAGAACGGGGCAACTCGCGTGCTTA
TGCCCAACTGGCTTCTGAAGAAACCGTTCACCGGCCTGGCCTATACGCTGGTGAGTTTTATGCAGCGCCT
GATATGGCTTGCCGCCATGCTCCCCCTGCTCTGCCTGTGTGTTTTAATCGGACTGATAGAAGGTCTAGTA
CAACGGGACTTGAGGCGGTTTGGCTCCGGGCTGAAATCGGTTTTTCTCCACCGCTACGTCATCAGGTCCG
GCAGTTCAGTCGCCACCACGCTGTGGGTGTTTTATCTGGCACAGCCGCTGTTTCTGCCCTCTATGCTGAT
TTTACTGCCTGCCACCTTATGGTTTGGAGTAACGGTATGGATAGTGGCTGGTAGCTTTAAGCGCTGGTTA
TAA
 Primer design