SecReT4
Protein ID: 238892816
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0627
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]617570..618088 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDC4X2I8
KEGG IDkpu:KP1_0627
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 172 a.a.     [Download]
>gi|238892816|ref|YP_002917550.1| hypothetical protein KP1_0627 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MARGPALILLLPCLALAQPLPEAYLRAAEHFRVPPELLWAVTQTESGANLNGRHLPWPWTLNIKGTGYRY
ASREQACQALLAAIRRISPKRIDVGLGQINIGWHRAYFDSPCDALHPLQNLSLTARLLRKRYDERPGSWL
NAAARYHRPAGGAPAARYRKLVSRHLQRATPP
 
Nucleotide Sequence: 519 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c618088-617570 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGCGCGAGGTCCAGCCCTGATCCTGCTGCTGCCCTGCCTGGCGCTGGCACAGCCTCTGCCGGAAGCGT
ACCTGCGCGCCGCAGAGCATTTCCGCGTGCCGCCGGAGCTACTATGGGCCGTCACGCAGACCGAAAGCGG
CGCGAACCTGAACGGCAGACATCTTCCGTGGCCGTGGACGCTCAATATCAAAGGGACCGGCTACCGCTAC
GCCAGCCGGGAGCAGGCCTGTCAGGCGCTGCTGGCCGCTATCCGCCGCATCAGCCCGAAGCGCATTGACG
TGGGGCTCGGGCAAATCAATATCGGCTGGCACCGGGCGTATTTTGACTCTCCCTGCGATGCCTTGCATCC
GCTGCAGAACCTGTCGCTCACCGCCCGCCTGCTGCGTAAGCGCTACGATGAACGTCCCGGAAGCTGGCTC
AATGCTGCCGCCCGTTATCACCGTCCTGCTGGCGGCGCGCCTGCCGCACGCTACCGCAAGCTGGTCAGCC
GCCATCTGCAACGGGCAACACCGCCATGA
 Primer design